DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxf1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_001039226.1 Gene:foxf1 / 734087 XenbaseID:XB-GENE-478922 Length:373 Species:Xenopus tropicalis


Alignment Length:395 Identity:106/395 - (26%)
Similarity:164/395 - (41%) Gaps:99/395 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 AASMSAAGLSGTYGAMPPGSREMETGSPNSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQN 225
            ::.||||  :..:|..|.........:......:.:.:|         .|||||||:||.||||:
 Frog    16 SSPMSAA--TDKHGGQPSVMESANCATKTKKTNAGIRR
P---------EKPPYSYIALIVMAIQS 69

  Fly   226 NPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDS 290
            :||:.|||||||||:...|||:|.:.|.|:||:||:||.|:||:|:|:...:||||.:||:.|.|
 Frog    70 SPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPAS 134

  Fly   291 GNMFENGCYLRRQKRFKDEKKEAIRQLHK-------------------------SPSHSSLEA-- 328
            ..|||.|.:.||.:.|: .|.:|::.::.                         .|:..||::  
 Frog   135 EFMFEEGSFRRRPRGFR-RKCQALKPMYSMMNGLGFNHIPETYSFQGASGTIACPPNSLSLDSGI 198

  Fly   329 -----------TSPGKKDHEDSHHMHHHHHSRL--------DHHQHHKEAGGASIAGVNVLSAAH 374
                       ...|...|..||...:..||.:        ..:.|| ::|...:.|..|:....
 Frog   199 GMMNGHLPSNVDGMGLSGHPVSHIAANGGHSYMGSCTGSSGGDYSHH-DSGSPLLGGGGVMEPHS 262

  Fly   375 SKDAEALAMLHANAELCLSQQPQHV------PTHHHHQHHQLQQEELSAMMANRCHPSLITDYHS 433
            ...:.|.|...:.:...:.|||...      |.......|.|.|..|                |.
 Frog   263 VYSSPASAWAPSASTPYIKQQPLSPCNSAANPLSSSLSSHSLDQSYL----------------HQ 311

  Fly   434 SMHPLKQEPSGYTPSSHPFSINRLLPTESKADIKMYDMSQYA-GYNALSPLTNSHAALGQDSYY- 496
            :.|....|..|             :|........|.|..::. .:||::. ::.|:  |..||| 
 Frog   312 NSHNTASELQG-------------IPRYHSQSPSMNDRKEFVFSFNAMAS-SSMHS--GSGSYYH 360

  Fly   497 QSLGY 501
            |.:||
 Frog   361 QQVGY 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 7/47 (15%)
FH 210..298 CDD:214627 52/87 (60%)
foxf1NP_001039226.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51 6/36 (17%)
Forkhead 53..139 CDD:365978 50/85 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..255 3/19 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..306 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.