DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and Foxb2

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_001162056.1 Gene:Foxb2 / 691398 RGDID:1585019 Length:425 Species:Rattus norvegicus


Alignment Length:361 Identity:125/361 - (34%)
Similarity:160/361 - (44%) Gaps:106/361 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 PTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLS 263
            |...:.||:..|||||||||..||||::..:||.||:||:|||:.||:||::.||||||:||:||
  Rat     2 PRPGKSSYSDQKPPYSYISLTAMAIQHSAEKMLPLSDIYKFIMERFPYYREHTQRWQNSLRHNLS 66

  Fly   264 FNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLH---KSPSHSS 325
            |||||:||||.||:|||||||.||||.|:|||||.:|||:||||     .:|..|   .|.|...
  Rat    67 FNDCFIKIPRRPDQPGKGSFWALHPDCGDMFENGSFLRRRKRFK-----VLRADHAHLHSGSSKG 126

  Fly   326 LEATSPGKKDHEDSHHMHHHHHSRLDHHQHHKEAGGASIAGVNVLSAAHSKDAEALAMLHANAEL 390
            ...|.||  .|...||.||.||    ||.||                                  
  Rat   127 APGTGPG--GHLHPHHPHHAHH----HHHHH---------------------------------- 151

  Fly   391 CLSQQPQHVPTHHHHQHHQLQQEELSAMMANRCHPSLITDYHSSMHPLKQEPSGYTPS------- 448
                   |...||||.||..|.....        |.::..:|....|..|.|  :.||       
  Rat   152 -------HHAAHHHHHHHPPQPPPPP--------PHMVPYFHQQPAPAPQPP--HLPSQPAQQPP 199

  Fly   449 --------SHPFSINRLLPTESKADI-------KMYDMSQYAGYNALSPLTNSHAA--------- 489
                    |||..:.......:.|..       .:..:||:..|...|....:.||         
  Rat   200 PQSQPPQTSHPGKMQEAAAVAAAAAAAAAAAVGSVGRLSQFPPYGLGSAAAAAAAAAASTTGFKH 264

  Fly   490 -------LGQDSYYQSLGYHAPAGTTSLXHH-QYPL 517
                   :|:|  |:.:.........|:.|| .||:
  Rat   265 PFAIENIIGRD--YKGVLQAGGLPLASVMHHLGYPV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 3/9 (33%)
FH 210..298 CDD:214627 63/87 (72%)
Foxb2NP_001162056.1 FH 13..101 CDD:214627 63/87 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.