DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and Foxf1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:XP_006255786.2 Gene:Foxf1 / 687536 RGDID:1584229 Length:447 Species:Rattus norvegicus


Alignment Length:581 Identity:137/581 - (23%)
Similarity:187/581 - (32%) Gaps:274/581 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AEPPPSSAPVSMASSGGGG-----------PPSGGGGGGGGGGGGGPPPPSNNNPNPTSNGGSMS 59
            |.|||.||..|...||||.           ||.|||.|||||.||                    
  Rat    48 APPPPGSAAQSSGGSGGGSSHPMSAPDKQQPPHGGGTGGGGGAGG-------------------- 92

  Fly    60 PLARSAYTMNSMGLPVGGMSSVSPQAAATFSSSVLDSAAAVASMSASMSASMSASMNASMNGSMG 124
                                            ..:|.|||                     |...
  Rat    93 --------------------------------QAMDPAAA---------------------GPTK 104

  Fly   125 AAAMNSMGGNCMTPSSMSYASMGSPLGNMGGCMAMSAASMSAAGLSGTYGAMPPGSREMETGSPN 189
            |...|:                                                |.|..|     
  Rat   105 AKKTNA------------------------------------------------GVRRPE----- 116

  Fly   190 SLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRW 254
                                |||||||:||.||||::|::.|||||||||:...|||:|...|.|
  Rat   117 --------------------KPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGW 161

  Fly   255 QNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHK 319
            :||:||:||.|:||:|:|:...:||||.:||:.|.|..|||.|.:.||.:.|: .|.:|::.::.
  Rat   162 KNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFR-RKCQALKPVYS 225

  Fly   320 ------------------------SPSHSSLEATSPGKKDH---------EDSHHMHH------H 345
                                    :|:..:||........|         ..||.:.|      |
  Rat   226 MVNGLGFNHLPDTYGFQGSGGLSCAPNSLALEGGLGMMNGHLTGNVDGMALPSHSVPHLPSNGGH 290

  Fly   346 HH------SRLDHHQHHKEAGGAS------IAGVNVLSAAHSKDA-----EALAMLHANAELCLS 393
            .:      |....:.||..:..||      ..||....|.:|..|     .|.|.|::.|.. :.
  Rat   291 SYMGGCGGSAAGEYPHHDSSVPASPLLPAGAGGVMEPHAVYSSSAAAWPPAASAALNSGASY-IK 354

  Fly   394 QQP------------QHVPTH-----HHHQHHQLQQEELSAMMANRCHPSLITDYHSSMHPLKQE 441
            |||            ..:.||     :.||:......||..          |..|||      |.
  Rat   355 QQPLSPCNPAANPLSGSISTHSLDQPYLHQNSHNGPAELQG----------IPRYHS------QS 403

  Fly   442 PSGYTPSSHPFSINRLLPTESKADIKMYDMSQYA-GYNALSPLTNSHAALGQDSYYQSLGY 501
            ||                        |.|..::. .:||::. ::.|...|...|:|.:.|
  Rat   404 PS------------------------MCDRKEFVFSFNAMAS-SSMHTTGGGSYYHQQVTY 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 6/88 (7%)
FH 210..298 CDD:214627 51/87 (59%)
Foxf1XP_006255786.2 FH_FOXF1 118..216 CDD:410823 54/98 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.