DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and Foxb1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_071773.2 Gene:Foxb1 / 64290 MGIID:1927549 Length:325 Species:Mus musculus


Alignment Length:331 Identity:115/331 - (34%)
Similarity:151/331 - (45%) Gaps:108/331 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 PTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLS 263
            |...|.:|:..|||||||||..||||::|.:||.|||||:||||.||:||:|.||||||:||:||
Mouse     2 PRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLS 66

  Fly   264 FNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEA 328
            |||||:||||.||:|||||||.|||..|:|||||.:|||:||||..|.:     |.:|       
Mouse    67 FNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVLKSD-----HLAP------- 119

  Fly   329 TSPGKKDHEDSHHMHHHHHSRLDHHQHHKEAGGASIAGVNVLSAAHSKDAEALAMLHANAELCLS 393
                                                          ||.|:|...|...|:|   
Mouse   120 ----------------------------------------------SKPADAAQYLQQQAKL--- 135

  Fly   394 QQPQHVPTHHHHQHHQLQQEELSAMMANRCHPSLITDYHSSMHPL--KQEPSGYTPSSHPFSINR 456
                                .|||:.|:..|   :....::.:.|  ..:|||:   .|||:|..
Mouse   136 --------------------RLSALAASGTH---LPQMPAAAYNLGGVAQPSGF---KHPFAIEN 174

  Fly   457 LLPTESKADIKMYDMSQYAGYNALSP----------LTNSHAALGQ--DSYYQSLGYHAPAGTTS 509
            ::..|       |.|.....::|:.|          ||...::||.  ...|.|.|....|...|
Mouse   175 IIARE-------YKMPGGLAFSAMQPVPAAYPLPNQLTTMGSSLGTGWPHVYGSAGMIDSATPIS 232

  Fly   510 LXHHQY 515
            : ...|
Mouse   233 MTSGDY 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 3/9 (33%)
FH 210..298 CDD:214627 66/87 (76%)
Foxb1NP_071773.2 FH 13..101 CDD:214627 66/87 (76%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..325
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.