DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxg1c

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_001038680.1 Gene:foxg1c / 571323 ZFINID:ZDB-GENE-050419-26 Length:379 Species:Danio rerio


Alignment Length:345 Identity:105/345 - (30%)
Similarity:141/345 - (40%) Gaps:114/345 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 KPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRT 274
            |||:||.:||.|||:.:|.|.|||:.||:|||..||:||:|:|.|||||||:||.|.||||:||.
Zfish    90 KPPFSYNALIMMAIRQSPERRLTLNGIYEFIMGNFPYYRENRQGWQNSIRHNLSLNKCFVKVPRH 154

  Fly   275 PDKPGKGSFWTLHPDSGNMFENGC--YLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKDHE 337
            .|.||||::|.|.|.|.::|..|.  .|||:.......|.|:    |..:..|..|.|.|.. ..
Zfish   155 YDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTAASRAKLAM----KRGARLSSTAASAGLA-FA 214

  Fly   338 DSHH--------MHHHHHSRLDHHQHHKEAGGASIAGVNVLSAAHSKDAEALAMLHAN-AELCLS 393
            .|.:        :.|.|.|.                     :|||          |:| |...||
Zfish   215 GSFYWPVPPFVTLQHRHSSP---------------------AAAH----------HSNYAASVLS 248

  Fly   394 QQPQHVPTHHHHQHHQLQQEELSAMMANRCHPSLITDYHSSMHPLKQEPSGY-------TPSSHP 451
            |..:|..:              .|..|.|.           :.|..||.:.|       |.||..
Zfish   249 QSARHFSS--------------VAPAAERL-----------LIPSSQEATYYGMGCEQMTSSSSS 288

  Fly   452 FSINRLLPTESKADIKMYDMSQYAGYNALSPLTNSHAALGQDSYYQSLGYHAPAGTTSLXHHQYP 516
            ||.:..:|         ..:|....:|.||         .|.||:.|              ||.|
Zfish   289 FSTSASVP---------LPLSAPCSFNLLS---------NQSSYFYS--------------HQVP 321

  Fly   517 LAXGRAEQMLRSQQQQHLQQ 536
            ...|.:..   ||::.:|.:
Zfish   322 HTAGLSAW---SQEESYLSK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796
FH 210..298 CDD:214627 52/87 (60%)
foxg1cNP_001038680.1 FH 90..178 CDD:214627 52/87 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.