DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxq2

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_001098411.1 Gene:foxq2 / 565796 ZFINID:ZDB-GENE-050208-663 Length:244 Species:Danio rerio


Alignment Length:133 Identity:53/133 - (39%)
Similarity:81/133 - (60%) Gaps:14/133 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 DKPTTYRRSY-THAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRH 260
            |...|:.:|. |..||..|||:||:|||.::..:.|.|.:|||:|||.:|:::...:.|:||:||
Zfish    73 DHENTHVKSEGTDEKPAQSYIALISMAILDSDEKKLLLCDIYQWIMDHYPYFKSKDKNWRNSVRH 137

  Fly   261 SLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQL-----HKS 320
            :||.|:||:|..|:.:  |||.||.:||.:...|.||.|.||:.|      ..||::     :..
Zfish   138 NLSLNECFIKAGRSDN--GKGHFWAIHPANFQDFSNGDYHRRRAR------RRIRRVTGQLPYAL 194

  Fly   321 PSH 323
            |:|
Zfish   195 PAH 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 4/12 (33%)
FH 210..298 CDD:214627 40/87 (46%)
foxq2NP_001098411.1 Forkhead 87..171 CDD:278670 39/85 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.