DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxi4.1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:XP_012818282.1 Gene:foxi4.1 / 549541 XenbaseID:XB-GENE-5996107 Length:381 Species:Xenopus tropicalis


Alignment Length:302 Identity:102/302 - (33%)
Similarity:137/302 - (45%) Gaps:56/302 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 MNSMGLP------VGGMSSVSPQAAATFSSSVLDSAAAVASMSASMSASMSASMNASMNGSMGAA 126
            |||:.||      ..|:....|:.|...|    :.|....:.|.....::.:|..|. |..:|..
 Frog     1 MNSIHLPSHQRTSAPGLHQHRPKGAQEAS----EMAVYCDNFSMYHQQNLHSSQRAP-NYGIGDY 60

  Fly   127 AMNSMGGNCMTPSSMSYASMGSPLGNMGGCMAMSAASMSAAGLSGTYGA--MPPGSREMETGSPN 189
            |          |.:..|..:|.|           ..|.|.:.|.|...|  |||..|.......|
 Frog    61 A----------PPTNPYLWLGGP-----------GVSNSPSYLHGNSPASFMPPSYRSQRQFLSN 104

  Fly   190 SLGRSRVD----KPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQN 250
            |......|    ...:........:|||||.:||.|||||.|.:.||||:|||::.|.||||:::
 Frog   105 SSSFCGTDLSWLSVASQEELLKVVRPPYSYSALIAMAIQNAPEKKLTLSQIYQYVADNFPFYKRS 169

  Fly   251 QQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKK-EAI 314
            :..|||||||:||.||||.|:||..|.||||::|||.|:...||:||.:.|::||..|... ||:
 Frog   170 KAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRRSDSSSAEAV 234

  Fly   315 -----------------RQLHKSPSHSSLEATSPGKKDHEDS 339
                             ..|..:||...|||.|.|:|....|
 Frog   235 TVKGEEGRPALGGKGGESPLMLTPSSPELEAASDGRKSTSPS 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 19/94 (20%)
FH 210..298 CDD:214627 53/87 (61%)
foxi4.1XP_012818282.1 Forkhead 129..214 CDD:365978 51/84 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.