DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and Foxi3

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_001102819.1 Gene:Foxi3 / 502846 RGDID:1561816 Length:400 Species:Rattus norvegicus


Alignment Length:525 Identity:141/525 - (26%)
Similarity:186/525 - (35%) Gaps:203/525 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YAEPPPSSAPVSMASSGGGGPPSGGGGGGGGGGGGGPPPPSNNNPNPTSNGGSMSPLARSAYTMN 69
            ||.||.::|...:..:|    |..||.....|..|.||||....|     |..:.|         
  Rat    35 YAAPPAAAANPYLWLNG----PGVGGPASAAGYLGAPPPPPGAAP-----GAFLQP--------- 81

  Fly    70 SMGLPVGGMSSVSPQAAATFSSS----VLDSAAAVASMSASMSASMSASMNASMNGSMGAAAMNS 130
                         |.|..||:.:    ...||||.||.:                   |:||   
  Rat    82 -------------PAAPGTFAGAQRGFTQPSAAAPASPA-------------------GSAA--- 111

  Fly   131 MGGNCMTPSSMSYASMGSPLGNMGGCMAMSAASMSAAGLSGTYGAMPPGSREMETGSPNSLGRSR 195
                   |..:.:.||.                                              ||
  Rat   112 -------PGELGWLSMA----------------------------------------------SR 123

  Fly   196 VDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRH 260
            .|.....|       |||||.:||.||||:.|.|.||||.||||:.|.||||::::..|||||||
  Rat   124 EDLMKMVR-------PPYSYSALIAMAIQSAPERKLTLSHIYQFVADNFPFYQRSKAGWQNSIRH 181

  Fly   261 SLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQL------HK 319
            :||.||||.|:||..|.||||::|||.|:...||:||.:.|:::|    :.||...|      .|
  Rat   182 NLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRRR----RAEASSNLTVPSGTSK 242

  Fly   320 SPSHSS-------LEATSPGKKDHEDSHHMHHHHHSRLDHHQHHKEAGG----ASIAGVNVLSAA 373
            |...||       ||..||.               |.|...|..:...|    ||..|.:.|::.
  Rat   243 SDGQSSRLRVSGKLEGDSPS---------------SMLRPSQSPEPPEGTKSTASSPGASTLTST 292

  Fly   374 HSKDA--EALAMLHANAELCLSQQPQHVPTHHHHQHHQLQQEELSAMMANRCHPSLITDYHSSMH 436
            ...:.  .:...|..||                           |:|...|..|.      |..|
  Rat   293 PCLNTFLSSFNTLSVNA---------------------------SSMSTQRTLPG------SRRH 324

  Fly   437 PLKQEPSGYT--PSSHPFSINRLLPTESKADIKMYDMSQYAGYNALSPLTNSHAALGQDSYYQSL 499
            |      |.|  |||..|      |:.|..|..: |..|.:.....|.|::.::.....|..||.
  Rat   325 P------GGTQLPSSTTF------PSTSIPDSSL-DSVQLSTVGGGSQLSSYYSPFSGGSGDQSS 376

  Fly   500 GYHAP 504
            .:.:|
  Rat   377 PFGSP 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 10/88 (11%)
FH 210..298 CDD:214627 54/87 (62%)
Foxi3NP_001102819.1 Forkhead 131..217 CDD:278670 54/92 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.