DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxj1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:XP_012827170.1 Gene:foxj1 / 496834 XenbaseID:XB-GENE-853648 Length:512 Species:Xenopus tropicalis


Alignment Length:477 Identity:111/477 - (23%)
Similarity:174/477 - (36%) Gaps:147/477 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 QAAATFSSSVLDSAAAVASMSASMSASMSASMNASMNGSMGAAAMNSMGGNCMTPSSMSYASMGS 148
            |...:|||||        ::..|:::.......:.:|.::|.|           |||        
 Frog    99 QGQDSFSSSV--------NLDDSLTSLQWLQEFSILNANVGKA-----------PSS-------- 136

  Fly   149 PLGNMGGCMAMSAASMSAAGLSGTYGAMPPGSREMETGSPNSLGRSRVD-------KPTTYRRSY 206
              |:..|...:|.|..|..........||     ...|.|.|...||..       :...|:.: 
 Frog   137 --GDSHGYKHLSGAPCSPLAADPACLGMP-----HTPGKPISSSTSRASHLGLQPMEDIDYKTN- 193

  Fly   207 THAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKI 271
            .|.||||||.:||.||:|.:....:|||.||::|.|.|.::|.....|||||||:||.|.||:|:
 Frog   194 PHVKPPYSYATLICMAMQASKKTKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKV 258

  Fly   272 PRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKD- 335
            ||..|:||||.||.:.|...:...||..          ||..:..:...|:.:|.:|.:.|..: 
 Frog   259 PREKDEPGKGGFWKIDPQYADRLMNGAM----------KKRRLPPVQIHPAFASAQAAASGNSNR 313

  Fly   336 --------HEDSHH----------------MHHHHHSRLDHHQHHK------------------- 357
                    :.:||.                :..|..:.:...:.||                   
 Frog   314 GSPWQLSVNSESHQLLKEFEEATGEQGWNALGEHGWNAISDGKSHKRKQPLPKRMFKAPRLSSSP 378

  Fly   358 --------EAGG------------ASIAGVNVLSAAHSKDAEALAMLHANAELCLSQQPQHVPTH 402
                    |.|.            :|:.|||..:....:....|:.:..:.:|.:         |
 Frog   379 MLCQEEQTELGSLKGDFDWEVIFDSSMNGVNFSAFEDLEVTPPLSPVTRSVDLTV---------H 434

  Fly   403 HHH-----QHHQLQQEELSAMMANRC---HPSLITDYHSSMHPLKQEPSGYTPSS----HPFSIN 455
            ..|     |.:.|.|::  |::.|..   ...|.|.:  ..||.::..:.|..:|    ..|.:|
 Frog   435 GKHIDCPQQWYPLGQDQ--AVVQNSLDFDETFLATSF--LQHPWEENRNDYLSNSANIEQLFDLN 495

  Fly   456 RLLPTESKADIKMYDMSQYAGY 477
            ...|.|      :.|.|....|
 Frog   496 EEFPAE------LNDWSALGSY 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 19/95 (20%)
FH 210..298 CDD:214627 44/87 (51%)
foxj1XP_012827170.1 Forkhead 197..283 CDD:278670 43/85 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.