DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxd1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_001008148.1 Gene:foxd1 / 493510 XenbaseID:XB-GENE-488077 Length:329 Species:Xenopus tropicalis


Alignment Length:196 Identity:81/196 - (41%)
Similarity:114/196 - (58%) Gaps:23/196 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 YGAMPPGS------REMETGSPNSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRML 231
            :|.:.|.|      ::...|:....|||.:            .|||||||:||||||..:|.:.|
 Frog    37 HGDLLPTSPQSSATKDPYKGTGGGGGR
SAL------------VKPPYSYIALITMAILQSPKKRL 89

  Fly   232 TLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFEN 296
            |||||.:||.:.||:||:....|||||||:||.|||||||||.|..||||::|||.|:|.:||:|
 Frog    90 TLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDN 154

  Fly   297 GCYLRRQKRFKDEKKEAIRQLHKSPSH---SSLEATSPGKKDHEDSHHMHHHHHSRLDHHQHHKE 358
            |.:|||:||||  :::|...:.:.|.|   :|..:..|....:.......|.|.:.:...|..::
 Frog   155 GSFLRRRKRFK--RQQAPELVLREPGHFLPASAYSYGPYSCAYGIQLQPFHPHSALIAFQQQQQQ 217

  Fly   359 A 359
            |
 Frog   218 A 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 7/41 (17%)
FH 210..298 CDD:214627 57/87 (66%)
foxd1NP_001008148.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 4/25 (16%)
Forkhead 68..153 CDD:365978 55/84 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.