DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and fd96Ca

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster


Alignment Length:388 Identity:118/388 - (30%)
Similarity:175/388 - (45%) Gaps:76/388 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 PTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLS 263
            |...|.||...|||||||||..|||.::|.:||.||:||:||.|.||:||:|.||||||:||:||
  Fly     2 PRPSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLS 66

  Fly   264 FNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFK---------DEKKEAIRQLHK 319
            |||||:|:||.||:||||::|.|||.:.:|||||..|||:||||         :|:..|:..|::
  Fly    67 FNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNR 131

  Fly   320 SPSHSSLEATSPGKKDHEDSHHMHHHHHSRLD------HHQHHKEAGG--------ASIAGVNVL 370
                ......:.|...|.....|::....|||      .|..:....|        ||::|.:..
  Fly   132 ----FFFTTRNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHT 192

  Fly   371 SAAHSKDAEALAMLHANAELCLSQQPQH--------VPTHHHHQHHQLQQE---------ELSAM 418
            :.|........|:..:..|..||.:|:.        .|....|.......|         |.|.:
  Fly   193 NLADMGLTNLPALTSSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDIDVVECSGI 257

  Fly   419 MANRCHPSLITDYHSSMHPLKQEPSGYTPSSHPFSINRLLP---TESKADI------------KM 468
            ......|:...:|.|:....:.|..  .|..|..:....:|   ..:.|::            ..
  Fly   258 SRYPTTPAASEEYMSASRSSRTEDP--LPPMHTINAGAHVPFLHYATGANVAGLPASGIPNSPTT 320

  Fly   469 YDMS-QYAGYNALSPLTNSHAALGQDSYYQSLGYHAPAGTTSLXHHQY--PLAXGRAEQMLRS 528
            |::: .:..:...:|:.|.|     :.||.::...|||       .||  |.. .|.:..:|:
  Fly   321 YELAISHPLFMMAAPIANMH-----NIYYNNVTLVAPA-------QQYRSPEVQNRIDNDMRT 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 4/9 (44%)
FH 210..298 CDD:214627 59/87 (68%)
fd96CaNP_001287516.1 FH 13..101 CDD:214627 59/87 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445517
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.