DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxo

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_001262557.1 Gene:foxo / 41709 FlyBaseID:FBgn0038197 Length:622 Species:Drosophila melanogaster


Alignment Length:651 Identity:155/651 - (23%)
Similarity:244/651 - (37%) Gaps:147/651 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 AMNSMGGNCMTPSSMSYASMGSPLGNMGGCMAMSAASMSAAGLSGTYGA---MPPGSREMETGSP 188
            ||:.:||:  .|..:.:........|...|............|..|..:   :.||.      |.
  Fly    20 AMDQLGGD--LPLDVGFEPQTRARSNTWPCPRPENFVEPTDELDSTKASNQQLAPGD------SQ 76

  Fly   189 NSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYR----- 248
            .::..:...|..:.||   :|....||..|||.||.:...:.||||:||::::...|:::     
  Fly    77 QAIQNANAAKKNSSRR---NAWGNLSYADLITHAIGSATDKRLTLSQIYEWMVQNVPYFKDKGDS 138

  Fly   249 QNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDS---------GNMFENGCYLRRQK 304
            .:...|:|||||:||.::.|:::..  :..||.|:|.|:|::         ....|...|.:|:.
  Fly   139 NSSAGWKNSIRHNLSLHNRFMRVQN--EGTGKSSWWMLNPEAKPGKSVRRRAASMETSRYEKRRG 201

  Fly   305 RFKDEKKEAIRQL------HKSPSHSSLEATSPGKKDHEDSHHMHHHHHSRLDHHQHHKEAGGAS 363
            |.| ::.||:||.      ..:||.||  :.|.| .||.....:|.....:|......:.:..||
  Fly   202 RAK-KRVEALRQAGVVGLNDATPSPSS--SVSEG-LDHFPESPLHSGGGFQLSPDFRQRASSNAS 262

  Fly   364 IAGVNVLSAAHSKDAE---ALAMLHANAELCLSQQPQHVPTHHHHQHHQLQQEELSAMMANR--- 422
            ..|  .||...::|.|   ...:.:.|..:.              |.|....|||:..||:.   
  Fly   263 SCG--RLSPIRAQDLEPDWGFPVDYQNTTMT--------------QAHAQALEELTGTMADELTL 311

  Fly   423 CHPSLITDYHSSMHPLKQEPSGYTPSSHPFSINRLLPTESKADIKMYDMSQYA------GYNALS 481
            |:........:|..|.:..|..|.|..|           .:|..:....|.||      |||.|.
  Fly   312 CNQQQQGFSAASGLPSQPPPPPYQPPQH-----------QQAQQQQQQQSPYALNGPASGYNTLQ 365

  Fly   482 PLTNS--HAALGQDSYYQSLGYHAPAGTTSLXHHQYP---------------LAXGRAEQMLRSQ 529
            |.:..  |.:|.....:.:....:|...|:. ...||               :. |.|:......
  Fly   366 PQSQCLLHRSLNCSCMHNARDGLSPNSVTTTMSPAYPNSEPSSDSLNTYSNVVLDGPADTAALMV 430

  Fly   530 QQQHLQQQHQQHQQQQQQHQ------------LHQQQQ-----------------QMQQSAQQLT 565
            |||..|||.||.....:.:.            |:.:.|                 .:::..||..
  Fly   431 QQQQQQQQQQQLSASLEDNNCASTLIGQCLEVLNNEAQPIDEFNLENFPVGNLECNVEELLQQEM 495

  Fly   566 SAS-----NTPATSAK---ASGKAGSASASGSG--SGSGSGSGSNYS--------QKLQQQHQQQ 612
            |..     |.|..:..   .:..:|..|.|...  |...|.|||:.|        |:.|||.|.|
  Fly   496 SYGGLLDINIPLATVNTNLVNSSSGPLSISNISNLSNISSNSGSSLSLNQLQAQLQQQQQQQQAQ 560

  Fly   613 QQQQAAAQQQHHQQQQQLLQELQEDSSNITSDLSEEQLQQHQAAQQQLYNNYQQYAAAAGYRNWN 677
            |||||..|||.|||.||.|.....::|:.:.:|:.:....:..|:.|    |.|.:......:|.
  Fly   561 QQQQAQQQQQQHQQHQQQLLLNNNNNSSSSLELATQTATTNLNARVQ----YSQPSVVTSPPSWV 621

  Fly   678 H 678
            |
  Fly   622 H 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 15/84 (18%)
FH 210..298 CDD:214627 30/101 (30%)
foxoNP_001262557.1 FH 95..175 CDD:238016 27/81 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445518
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.