DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and FoxP

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_001247011.1 Gene:FoxP / 41182 FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster


Alignment Length:301 Identity:74/301 - (24%)
Similarity:136/301 - (45%) Gaps:49/301 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 GGNCMTPSSMSYASMGSPLGNMGGCMAMSAASMSAAGLSGTYGAMPPGSREMET-----GSPNSL 191
            |..|.:|.:::  |:|.|:........::...:::..|.    ::...:.:..|     |.|..|
  Fly   246 GKFCRSPLTVN--SIGRPIRQTNSPSPLNLPMVNSTNLC----SIKKRNHDKNTFSINGGLPYML 304

  Fly   192 GRSRVDKPTTYRRS---YTHA--KPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQ 251
            .|:.:|......|:   |.:|  :||::|.|||..||.::|.:.|||:|||.:..:.|.::|:|.
  Fly   305 ERAGLDVQQEIHRNREFYKNADVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNA 369

  Fly   252 QRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQ 316
            ..|:|:||.:||.:.|||:.     :...||||.:   ..|.|....:|.|.:..|.|...:...
  Fly   370 ATWKNAIRTNLSLHKCFVRY-----EDDFGSFWMV---DDNEFVKRRHLSRGRPRKYEPSSSPNS 426

  Fly   317 LH--------KSP-SHSSLEATS--PGKKDHEDSHHMHHHHHSRLDHHQHHKEAGGASIAGVNVL 370
            ..        |:| .:.:...||  ||..:..||:  :.:...|:         |.....|.:.|
  Fly   427 CQSGNGVPTDKNPCDNCTQHCTSLPPGADNPLDSN--NPNDLGRI---------GCLPYCGSDGL 480

  Fly   371 SAAHSKDAEAL--AMLHANAELCLSQQPQHVPTHHHHQHHQ 409
            |.| |||...:  .|:.:|:.|.:.:...::.....::|::
  Fly   481 SKA-SKDYSNMDSGMIESNSHLTIDEYSTNMYESSANEHNR 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 15/84 (18%)
FH 210..298 CDD:214627 33/87 (38%)
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777
FH 328..400 CDD:238016 31/79 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445490
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.