DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxf2a

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_001077284.1 Gene:foxf2a / 407681 ZFINID:ZDB-GENE-110407-5 Length:383 Species:Danio rerio


Alignment Length:368 Identity:102/368 - (27%)
Similarity:162/368 - (44%) Gaps:88/368 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 TGSPNSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQ 249
            ||:......|.:.:|         .|||||||:.|.||||::||:.|||||||||:...|||:|.
Zfish    42 TGNKGKKSNSGMRRP---------EKPPYSYIAPIVMAIQSSPTKRLTLSEIYQFLQARFPFFRG 97

  Fly   250 NQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAI 314
            :.|.|:||:||:||.|:||:|:|:...:||||.:||:.|.|..|||.|.:.||.:.|: .|.:|:
Zfish    98 SYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPGSEFMFEEGSFRRRPRGFR-RKCQAL 161

  Fly   315 RQLHKS-----------PSHSSLEATSPGKKDHEDSHHMH---------HHHHSRL--DHHQHH- 356
            :.:::.           |.:...::.|.....|.:|:::.         |..:..|  .||..| 
Zfish   162 KPMYRMMNGIGFGASMLPQNFDFQSPSASLACHANSYNLDMMSNAVQGVHAGYDGLGAGHHVSHM 226

  Fly   357 -KEAGGASIAGVNVLS-AAHSKDAEALAMLHANAELCLSQQPQHVPTHHHHQHHQLQQEELSAMM 419
             ...|...:....|.| ..:..|:              |..|.|.|            ..:|..:
Zfish   227 SPSTGSTYMTACQVASNGEYGPDS--------------SNSPLHSP------------PTMSGSL 265

  Fly   420 ANRCH-PSLITDYH---SSMHP-LKQEP--------SGYTPSSHPFSINR-LLPTESKADIKMYD 470
              .|| |......|   |.:.| :||:|        ||...|..|:|:.: .|....:....:..
Zfish   266 --ECHSPYGAASAHGASSGVSPYIKQQPLSSSSPTSSGLHSSMPPYSLEQSYLHHNGRDSADISG 328

  Fly   471 MSQYAGYNA-----------LSPLTNSHAALGQDSYYQSLGYH 502
            ||:|..:::           .:.:|:.|.:.....|:..|.:|
Zfish   329 MSRYQSHSSPVCDRKDFVLNFNGITSFHPSTSGSYYHHQLHHH 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 4/23 (17%)
FH 210..298 CDD:214627 51/87 (59%)
foxf2aNP_001077284.1 FH 58..146 CDD:214627 51/87 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.