DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxg1b

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_998079.2 Gene:foxg1b / 405850 ZFINID:ZDB-GENE-040426-2437 Length:341 Species:Danio rerio


Alignment Length:317 Identity:103/317 - (32%)
Similarity:143/317 - (45%) Gaps:63/317 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 PPGSREMETGSPNSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIM 241
            ||...||:...     |...:.....::.....|||:||.:||.|||:.:|.:.|||:.||:|||
Zfish    49 PPEDAEMDNAQ-----RDAEEPELQTKKGKKFDKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIM 108

  Fly   242 DLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGC--YLRRQ- 303
            ..||:||:::|.|||||||:||.|.||||:||..|.||||::|.|.|.|.::|..|.  .|||: 
Zfish   109 KNFPYYREHKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRS 173

  Fly   304 --KRFKDEKKEAIR------QLHKSPSHSSLEATSPGKKDHEDSHHMHHHHHSRLDH---HQHH- 356
              .|.|...|..:|      .|.:.||:......||...       :||.|::...|   :|.| 
Zfish   174 ATSRGKLVMKRGLRFAPLGLGLGERPSNPLYWQLSPFLP-------LHHSHYNGSAHGFLNQGHT 231

  Fly   357 -----------------KEAGGASIAGVNVLSAAHSKDAEALAML--HANAELCLSQQPQHVPTH 402
                             ::..|||...:| ||..:.....|..:|  |....:..:||||.:|:.
Zfish   232 YGTLLPGVEPLGNGDMSRQILGASSGSIN-LSNGYGVSPPAAGLLSGHNGYFVPGAQQPQSLPSA 295

  Fly   403 HHHQHHQLQQEELSAMMANRCHPSLITDYHSSMHPLKQEPSGYTPSSHPFSINRLLP 459
            ..:.....|...||        .||.|...|...||    ||...|.|    .|:.|
Zfish   296 PGYGISSSQSPLLS--------DSLRTSLPSFTSPL----SGGLLSQH----KRVAP 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 5/31 (16%)
FH 210..298 CDD:214627 50/87 (57%)
foxg1bNP_998079.2 FH 77..165 CDD:214627 50/87 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.