DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxd1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_998078.2 Gene:foxd1 / 405849 ZFINID:ZDB-GENE-040426-2094 Length:343 Species:Danio rerio


Alignment Length:347 Identity:112/347 - (32%)
Similarity:152/347 - (43%) Gaps:81/347 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 GSPNSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQN 250
            |||..:..|....|.......|..|||||||:||||||..:|.:.||||||..||.:.||:||:.
Zfish    50 GSPPGVDASPARDPYKPASKNTLVKPPYSYIALITMAILQSPKKRLTLSEICDFISNRFPYYREK 114

  Fly   251 QQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIR 315
            ...|||||||:||.|||||||||.|..||||::|||.|:|.:||:||.:|||:||||.::...:.
Zfish   115 FPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQQAPELL 179

  Fly   316 QLHKS--PSHSSLEATSPGKKDHEDSHHMH---HHHHSRLDHHQHHKEAGGASIAGVNVLSAAHS 375
            :.|..  ||     |.:.|...:...:.:.   :|.||.|...|..::...........|..|  
Zfish   180 REHGGFLPS-----AAAYGYGPYGCGYGLQLQSYHAHSALLAFQQQQQQQPPPSRNTGTLIPA-- 237

  Fly   376 KDAEALAMLHANAELCLSQQPQHVPTHHHHQHHQLQQEELSAMMANRCHPSLITDYHSSMHPLKQ 440
                                |..:||             .:.:..:|.:|.|.....||:....:
Zfish   238 --------------------PSLMPT-------------TTELTRSRFYPPLSPGISSSLQTAAK 269

  Fly   441 EPSGYTPSSHPFSINRLLPTESKADIKMYDMSQYAGYNALSPLTNSHAALGQDSYYQSL-----G 500
            .|    ....||||:.::.                  ::||| |:||.|.........|     .
Zfish   270 SP----VHRSPFSIDSIIG------------------SSLSP-THSHCASRTSPVVPVLPPALAA 311

  Fly   501 YHAP-------AGTTSLXHHQY 515
            .|:|       .|.||| |..|
Zfish   312 QHSPNPLLGVLHGPTSL-HETY 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 6/22 (27%)
FH 210..298 CDD:214627 57/87 (66%)
foxd1NP_998078.2 Forkhead 74..160 CDD:278670 56/85 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.