DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and FOXI2

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_997309.2 Gene:FOXI2 / 399823 HGNCID:32448 Length:318 Species:Homo sapiens


Alignment Length:343 Identity:99/343 - (28%)
Similarity:135/343 - (39%) Gaps:131/343 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PSSAPVSMASSGGGGPPSGGGGGGGGGGGGGPPPPSNNNPNPTSNGGSMSPLARSAYTMNSMGLP 74
            |||||...|.: ...||....|..|..|||         |....|..::||.:.::         
Human    10 PSSAPPGQAQA-TAHPPGYEPGDLGAVGGG---------PLLWVNAPALSPKSYAS--------- 55

  Fly    75 VGGMSSVSPQAAATFSSSVLDSAAAVASMSASMSASMSASMNASMNGSMGAAAMNSMGGNCMTPS 139
              |.....|.||.                                                    
Human    56 --GPGPAPPYAAP---------------------------------------------------- 66

  Fly   140 SMSYASMGSPLGNMGGCMAMSAASMSAAGLSGTYGAMPPGSREMETGSPNSLGRSRVDKPTTYRR 204
              ||.:.|..||..||   ::.|.::...||        |.:|:                     
Human    67 --SYGAPGPLLGAPGG---LAGADLAWLSLS--------GQQEL--------------------- 97

  Fly   205 SYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFV 269
             ....:|||||.:||.||||:.|.|.||||:|||::...||||::::..|||||||:||.||||.
Human    98 -LRLVRPPYSYSALIAMAIQSAPLRKLTLSQIYQYVAGNFPFYKRSKAGWQNSIRHNLSLNDCFK 161

  Fly   270 KIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIR------------------- 315
            |:||..|.||||::|||.|:...||:||.:.|::|| :.|...|:|                   
Human   162 KVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKR-RAEASAAVRSGARSVGGAEAPALEPPSA 225

  Fly   316 ---QLHKSPSHSSLEATS 330
               .|..|||.|:.||.:
Human   226 ACLDLQASPSPSAPEAAT 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 12/88 (14%)
FH 210..298 CDD:214627 52/87 (60%)
FOXI2NP_997309.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 8/20 (40%)
Forkhead 102..188 CDD:278670 51/85 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.