DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxi4.2

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_989265.1 Gene:foxi4.2 / 394878 XenbaseID:XB-GENE-487658 Length:363 Species:Xenopus tropicalis


Alignment Length:207 Identity:77/207 - (37%)
Similarity:112/207 - (54%) Gaps:23/207 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 YASMGSPLGNMGGCMAMSAASMSAAGLSGTYGAMPPG----SREMETGSPNSLGRSRVD--KPTT 201
            |.|..:|...:||....:|.:.|.:  ...|  |||.    .|:....|| :.|.:.:.  ...:
 Frog    57 YTSPANPYLWLGGHGVNNAPNYSPS--PAPY--MPPSFGAPQRQFLPNSP-AFGGTELSWMSAAS 116

  Fly   202 YRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFND 266
            ........:|||||.:||.||||:...|.||||:|||::.:.||||::::..|||||||:||.||
 Frog   117 QEELLKMVRPPYSYSALIAMAIQHASDRRLTLSQIYQYVAENFPFYKKSKAGWQNSIRHNLSLND 181

  Fly   267 CFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQL---HKSP------- 321
            ||.|:||..:.||||::|||.|:...||:||.:.|::|...|.....|.::   |.:|       
 Frog   182 CFKKVPRDENDPGKGNYWTLDPNCEKMFDNGNFRRKRKPKSDANSAKIAKIGEDHLNPKGKESPP 246

  Fly   322 --SHSSLEATSP 331
              :.||.|..||
 Frog   247 MITPSSPEEPSP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 15/71 (21%)
FH 210..298 CDD:214627 50/87 (57%)
foxi4.2NP_989265.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Forkhead 125..210 CDD:306709 48/84 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..269 13/49 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..363
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.