DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxi3b

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_944600.1 Gene:foxi3b / 387258 ZFINID:ZDB-GENE-031126-4 Length:383 Species:Danio rerio


Alignment Length:296 Identity:91/296 - (30%)
Similarity:124/296 - (41%) Gaps:89/296 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PPPSNNNPNPTSNGGSMSPLARSAYTMNSMGLPVGGMSSVSPQAAATFSSSVLDSAAAVASMSAS 106
            ||||..:|..|                |.....:|..::.||.....|:|..::||         
Zfish    37 PPPSLPSPQRT----------------NPSSYELGDYAASSPNPYLWFNSPGMNSA--------- 76

  Fly   107 MSASMSASMNASMNGSMGAAAMNSMGGNCMTPS----SMSYASMGSPLGNMGGCMAMSAASMSAA 167
                      ..:.|:.|.|      |....|.    ...|...|.| |..||.:          
Zfish    77 ----------PYLGGTPGPA------GPSFVPQHYGMQRPYLGPGPP-GGPGGEL---------- 114

  Fly   168 GLSGTYGAMPPGSREMETGSPNSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLT 232
                ::.:||.....|:.                       .:|||||.:||.|||...|.|.||
Zfish   115 ----SWFSMPSQEDLMKL-----------------------VRPPYSYSALIAMAIHGAPERRLT 152

  Fly   233 LSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENG 297
            ||:|||::.|.||||.:::..|||||||:||.||||.|:||..|.||||::|||.|:...||:||
Zfish   153 LSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNG 217

  Fly   298 CYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGK 333
            .:.|::||..|...|      ||.|..:....|.|:
Zfish   218 NFRRKRKRKSDSLPE------KSSSGGNESGDSNGR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 14/92 (15%)
FH 210..298 CDD:214627 52/87 (60%)
foxi3bNP_944600.1 FH 130..218 CDD:214627 52/87 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.