DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and FoxL1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster


Alignment Length:376 Identity:114/376 - (30%)
Similarity:163/376 - (43%) Gaps:87/376 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 NGSM---GAAAMNSMGGNCMTPSSMSYASMGSPLGNMGGCMAMSAASMSAAGLSGTY-GAMPPGS 180
            ||||   ....:|||..|   |..:......:||         :.:::..||:.|.. |:..|..
  Fly     8 NGSMLPDNEELVNSMLAN---PDYLRTQVSPNPL---------APSAVGGAGMEGLMCGSFSPAF 60

  Fly   181 REMETGSPNSLGRSRVDKPTTY-RRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLF 244
            ......|..:|..:....|.:: ..|:...|||:|||:||.|||.:.|.:.||||.||:||||.|
  Fly    61 YYQGIDSFLALHNNIWGLPISFLHNSHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKF 125

  Fly   245 PFYRQNQQRWQNSIRHSLSFNDCFVKIPRTP------DKPGKGSFWTLHPDSGNMFENGCYLRRQ 303
            |:||:|:|.|||||||:||.|||||||||..      |..||||:|.|...:.:|||.|.|.||:
  Fly   126 PYYRENKQGWQNSIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRR 190

  Fly   304 KRFKDEKKEAIRQLH---------------KSPSHSSLEATSPGK--KDHEDSHHMHHHHHSRL- 350
            .|         ||.|               ...:.|:.|..||.:  .|.:...:...::..|: 
  Fly   191 TR---------RQRHCGHPNRYERESGKDSNDGNSSAAEIRSPSEPLSDFDIFCNERPNYSDRIT 246

  Fly   351 DHHQHHKEAGGASIAGVNVLSAAHSKDAEALAMLHANAELCLSQQPQHVPTHHHHQHHQLQQEEL 415
            |.|:.:....    .|.|.|   .:.:|..|..|....| |    |..|              :.
  Fly   247 DLHRQYLSVS----LGFNSL---FNNEARGLRPLPEIRE-C----PDDV--------------DA 285

  Fly   416 SAMMANRCHPSLITDYHSSMHPLKQEPSGYTPSSHPFSINRLLPTESKADI 466
            |:..:.....|:  :.|..:|    .||.:||     .:||...:.|.|.:
  Fly   286 SSSSSKAMQSSM--ELHEELH----SPSAFTP-----PLNRRETSSSGAPV 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 20/93 (22%)
FH 210..298 CDD:214627 56/93 (60%)
FoxL1NP_001246609.1 FH 91..185 CDD:214627 56/93 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445467
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.