DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and Foxl2

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:XP_003750619.1 Gene:Foxl2 / 367152 RGDID:1310041 Length:374 Species:Rattus norvegicus


Alignment Length:159 Identity:68/159 - (42%)
Similarity:91/159 - (57%) Gaps:27/159 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 AMPPGSREMETGSPNSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQF 239
            |.||        ||...|.:..:||...:      ||||||::||.|||:.:..:.||||.|||:
  Rat    29 ASPP--------SPGKGGGTAPEKPDPAQ------KPPYSYVALIAMAIRESAEKRLTLSGIYQY 79

  Fly   240 IMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQK 304
            |:..||||.:|::.|||||||:||.|:||:|:||......||::|||.|...:|||.|.| ||::
  Rat    80 IIAKFPFYEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMFEKGNY-RRRR 143

  Fly   305 RFKDEKKEAIRQLHKSPSHSSLEATSPGK 333
            |.|       |.....|:|     ..|||
  Rat   144 RMK-------RPFRPPPAH-----FQPGK 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 8/33 (24%)
FH 210..298 CDD:214627 48/87 (55%)
Foxl2XP_003750619.1 FH 50..138 CDD:214627 48/87 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.