DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxi1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_859424.1 Gene:foxi1 / 353313 ZFINID:ZDB-GENE-030505-1 Length:377 Species:Danio rerio


Alignment Length:351 Identity:105/351 - (29%)
Similarity:158/351 - (45%) Gaps:75/351 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 GNCMTPSSMSYASMGSPLGNMGGCMAMSAASMSAAGLSGT-YGAMPPGSREMETGSPNSLGRSRV 196
            |...:||:..|..|.||                  |::.| |.:.|.|...:::|. .|..|..:
Zfish    69 GEYSSPSTNPYLWMNSP------------------GITSTPYLSSPNGGSYIQSGF-GSNQRQFL 114

  Fly   197 DKPTTY-------------RRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYR 248
            ..||.:             :..:...:|||||.:||.|||||...:.||||:|||::.|.||||:
Zfish   115 PPPTGFGSADLGWLSISSQQELFKMVRPPYSYSALIAMAIQNAQDKKLTLSQIYQYVADNFPFYK 179

  Fly   249 QNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEA 313
            :::..|||||||:||.||||.|:.|..|.||||::|||.|:...||:||.:.|::||..|....:
Zfish   180 KSKAGWQNSIRHNLSLNDCFKKVARDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRRADGNAMS 244

  Fly   314 IRQ---LHKSPSHSSLEATSPGKKDHEDSHHMHHHHHSRLDHHQHHKEAGG--ASIAGVNVL--- 370
            ::.   |..:.:.|.:.|:.|..::...|...........:|........|  .||...|.:   
Zfish   245 VKSEDALKLADTSSLMSASQPSLQNSPTSSDPKSSPSPSAEHSPCFSNFIGNMNSIMSGNAVRSR 309

  Fly   371 --SAAHSKDAEALAMLHANAELCLSQQPQHVPTHHHHQHHQLQQEELSAMMANRCHPSLITDYHS 433
              |:||..|.....|  :..|:....:|.|:.|                   ||      .:|:|
Zfish   310 DGSSAHLGDFTQHGM--SGHEISPPSEPGHLNT-------------------NR------LNYYS 347

  Fly   434 SMHPLKQEPSGYTPS-SHPFSINRLL 458
            :.|    ..||...| |:.||:|.|:
Zfish   348 ASH----NNSGLINSISNHFSVNNLI 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 17/89 (19%)
FH 210..298 CDD:214627 51/87 (59%)
foxi1NP_859424.1 Forkhead 141..227 CDD:278670 50/85 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.