DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and slp1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster


Alignment Length:252 Identity:83/252 - (32%)
Similarity:119/252 - (47%) Gaps:48/252 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 REMETGSPNSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFP 245
            :|.|.|:|:...:......|        .||||||.:||.||||::|.:.|||:.|||::::.||
  Fly    99 QESEDGNPSKKQKMTAGSDT--------KKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFP 155

  Fly   246 FYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMF--ENGCYLRRQKRFKD 308
            :::.|::.|||||||:||.|.||.||||:.|.||||::|.|.|.:..:|  |....|||:.....
  Fly   156 YFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGAS 220

  Fly   309 EKK-EAIRQLHKSPSHSSLEATSPGKKDHEDSHHMHHHHHSRLDHHQHHKEAGGASIAGVNVLSA 372
            ..: .|.||...||    :.|.||                          ....||..|...:..
  Fly   221 RTRLAAYRQAIFSP----MMAASP--------------------------YGAPASSYGYPAVPF 255

  Fly   373 AHSKDAEALAMLHANAELCLSQQPQH--VPTHHHHQ-HHQLQQ----EELSAMMANR 422
            |.:..|.....::..|.....||.|:  .|..|||| .|..|.    ::|:|.:..|
  Fly   256 AAAAAAALYQRMNPAAYQAAYQQMQYQQAPQAHHHQAPHPAQMQGYPQQLNAELFQR 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 5/27 (19%)
FH 210..298 CDD:214627 48/89 (54%)
slp1NP_476730.1 FH 120..205 CDD:214627 46/84 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445500
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.