DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and CG32006

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster


Alignment Length:326 Identity:78/326 - (23%)
Similarity:130/326 - (39%) Gaps:80/326 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 KPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRT 274
            |||::|..:|.||:..|  ..:||.::..:|...|.|:|. :::|.|||||:||.:.||..  |.
  Fly   146 KPPFNYSHIIGMAMLQN--GRITLQQLCSWIEAKFAFFRV-RKKWNNSIRHNLSLHHCFRN--RK 205

  Fly   275 PDKPGKGSFWTL------------------HPDSGN----MFENGCYLRRQKRFKDEKKEAIRQL 317
            .::.|||.:|.|                  ||....    .:|   :|...::.|..:|...|.:
  Fly   206 REERGKGGYWELGVDPKKCDRKRIRNRKIFHPTQNQTAKLQYE---HLTEIQQAKSARKNHSRHI 267

  Fly   318 HKSPSHSSLEATSPGKKDHEDSHHMHHHHHSRLDHHQHHKEAGGASIAGVNVLSAAHSKDAEALA 382
            .||.: |||..||    :....:.:.|..|:..|.:...::.  .:|...::|     |....|.
  Fly   268 KKSKT-SSLPETS----EANIFNVVPHKKHNIADENDGQRQL--QTINKDDIL-----KKKSELD 320

  Fly   383 MLHANAELCLSQQPQHVPTHHHHQHHQLQQEELSAMMANRCHPSLITDYHSSMHPLKQEPSGYTP 447
            .:.::.|..|::. |::...:.|: .......:|| ..|.|   ...:::|.|.|:....|....
  Fly   321 TIVSSTESFLTES-QNLNCFNSHK-TDTTNTPISA-EKNFC---TFNNFYSEMTPVLASNSNIVE 379

  Fly   448 S----------SHP--FSINRLLPTESKADIKMYDMSQYAGYNALSPLTNSHAALGQDSYYQSLG 500
            .          |||  .:||             ||      |....|:.:|.|...| ..:.|.|
  Fly   380 DQNVSTDVSWPSHPCNITIN-------------YD------YTNFQPIVDSIAEQFQ-CLHDSAG 424

  Fly   501 Y 501
            |
  Fly   425 Y 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796
FH 210..298 CDD:214627 33/109 (30%)
CG32006NP_726538.1 FH 146..217 CDD:294049 29/75 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.