DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and FOXA2

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_068556.2 Gene:FOXA2 / 3170 HGNCID:5022 Length:463 Species:Homo sapiens


Alignment Length:493 Identity:200/493 - (40%)
Similarity:251/493 - (50%) Gaps:109/493 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SAYTMNSMGLPVGGMSSVSPQAAATFSSSVLDSAAAVASMSASMSASMSASMNASMNGSMGAAAM 128
            |...||: ||.:.||::....:||...|...:.:|...:||:.:.|.||.|: |.|  |.||.||
Human    33 SVSNMNA-GLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVGAGMSPSL-AGM--SPGAGAM 93

  Fly   129 NSMGGNCMTPSSMSYASMG-------SPLGNMGGCMAMSAASMSAAGLSGTYGAMPPGSREMETG 186
            ..|||:.   .:...|.||       ||||...               :|..|.:.|.: .|.:.
Human    94 AGMGGSA---GAAGVAGMGPHLSPSLSPLGGQA---------------AGAMGGLAPYA-NMNSM 139

  Fly   187 SP--NSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQ 249
            ||  ...|.||...|.||||||||||||||||||||||||.:|.:|||||||||:||||||||||
Human   140 SPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQ 204

  Fly   250 NQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAI 314
            |||||||||||||||||||:|:||:|||||||||||||||||||||||||||||||||.||:.|:
Human   205 NQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKQLAL 269

  Fly   315 RQ------------LHKSPSHSSL-EATSPGKKDHEDSHHMHHHHHSRLDHHQHHKEAGGASIAG 366
            ::            .....|.:.| ||..|..:....:    ...||.....|.||..|...:.|
Human   270 KEAAGAAGSGKKAAAGAQASQAQLGEAAGPASETPAGT----ESPHSSASPCQEHKRGGLGELKG 330

  Fly   367 VNVLSAAHSKDAEALAMLHANAELCLSQQPQHVPTHHHHQHHQLQQEELSAMMANRCHPSLITDY 431
            .         .|.||:            .|:..|:...      ||:..:.::....||.|..:.
Human   331 T---------PAAALS------------PPEPAPSPGQ------QQQAAAHLLGPPHHPGLPPEA 368

  Fly   432 HSSMHPLKQEPSGYTPSSHPFSINRLLPTES------------KADIKMYD-MSQYAGYN----- 478
            |     ||  |..:...:||||||.|:.:|.            |.|:|.|: :..|.||.     
Human   369 H-----LK--PEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPG 426

  Fly   479 --ALSPLTN----SHAALGQD-SYYQSLGYHAPAGTTS 509
              |:.|:||    ..:.|..| ||||.: |..|...:|
Human   427 SLAMGPVTNKTGLDASPLAADTSYYQGV-YSRPIMNSS 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 32/97 (33%)
FH 210..298 CDD:214627 79/87 (91%)
FOXA2NP_068556.2 Forkhead_N 23..164 CDD:369872 51/153 (33%)
FH_FOXA2 163..264 CDD:410813 92/100 (92%)
HNF_C 380..452 CDD:401339 23/71 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159761
Domainoid 1 1.000 175 1.000 Domainoid score I3657
eggNOG 1 0.900 - - E2759_KOG3563
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 273 1.000 Inparanoid score I2997
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1181467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm40869
orthoMCL 1 0.900 - - OOG6_105963
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4570
SonicParanoid 1 1.000 - - X1772
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.830

Return to query results.
Submit another query.