DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and Foxd2

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:XP_233422.5 Gene:Foxd2 / 313504 RGDID:1304642 Length:494 Species:Rattus norvegicus


Alignment Length:356 Identity:115/356 - (32%)
Similarity:142/356 - (39%) Gaps:116/356 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SAPVSMASSGGGGPPSGGGGGGGG-GGGGGPPPPSNNNPNPTSNGGSMSPLARSAYTMNSMGLPV 75
            |:|.:::.........|||.|||. ....||..|.:..|    :|..:.|....|....... ..
  Rat    15 SSPAALSEPDADIDVVGGGSGGGELTARSGPRAPRDVLP----HGHELPPEEAEADVAEDEE-ES 74

  Fly    76 GGMSSVSPQAAATFSSSVLDSAAAVASMSASMSASMSASMNASMNGSMGAAAMNSMGGNCMTPSS 140
            ||.|...|:|.                                  |..|||              
  Rat    75 GGCSDCEPRAL----------------------------------GPRGAA-------------- 91

  Fly   141 MSYASMGSPLGNMGGCMAMSAASMSAAGLSGTYGAMPPGSREMETGSPNSLGRSRVDKPTTYRRS 205
               |:.|||                ..|:....||..||... ..|.|:  |.:....|.     
  Rat    92 ---AAAGSP----------------GPGVQAARGATGPGPGP-GPGPPS--GGAATRSPL----- 129

  Fly   206 YTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVK 270
               .|||||||:||||||..:|.:.||||||.:||...||:||:....|||||||:||.||||||
  Rat   130 ---VKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVK 191

  Fly   271 IPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKD 335
            |||.|..||||::|||.|:|.:||:||.:|||:||||       ||....|              
  Rat   192 IPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFK-------RQPLPPP-------------- 235

  Fly   336 HEDSHHMHHHHHSRLDHHQHHKEAGGASIAG 366
                 |.|.|.|..|      ...|||:.||
  Rat   236 -----HPHPHPHPEL------LLRGGAAAAG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 17/88 (19%)
FH 210..298 CDD:214627 57/87 (66%)
Foxd2XP_233422.5 FH_FOXD1_D2-like 131..229 CDD:410820 65/104 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.