DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and Foxe3

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_056573.1 Gene:Foxe3 / 30923 MGIID:1353569 Length:288 Species:Mus musculus


Alignment Length:160 Identity:73/160 - (45%)
Similarity:98/160 - (61%) Gaps:14/160 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 GCMAMSAASMSAAGLSGTYGAMPPGSREMETGSPNSLGRSRVDKPTTY-------RRSYTHAKPP 212
            |..|:.:.:.|...|....||.|....|...|..::       :||..       ||.....|||
Mouse     9 GFPALPSLTPSGPQLPTLAGAEPGREPEEVVGGGDA-------EPTAVPGPGKRRRRPLQR
GKPP 66

  Fly   213 YSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDK 277
            ||||:||.||:.:.|.|.|||:.||:||.:.|.|||.:.::|||||||:|:.||||||:||.|..
Mouse    67 YSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYRDSPRKWQNSIRHNLTLNDCFVKVPREPGN 131

  Fly   278 PGKGSFWTLHPDSGNMFENGCYLRRQKRFK 307
            ||||::|||.|.:.:||:||.:|||:||||
Mouse   132 PGKGNYWTLDPAAADMFDNGSFLRRRKRFK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 13/60 (22%)
FH 210..298 CDD:214627 52/87 (60%)
Foxe3NP_056573.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 13/59 (22%)
FH 64..152 CDD:214627 52/87 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..189
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.