DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxa

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_571357.2 Gene:foxa / 30539 ZFINID:ZDB-GENE-990415-76 Length:355 Species:Danio rerio


Alignment Length:382 Identity:146/382 - (38%)
Similarity:186/382 - (48%) Gaps:80/382 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 SSMSYASMGSPLGNMG-----------GCMAMSAASMSAAGLSGTYGAMPPGSREMETGSPNSLG 192
            |.|.|.|...|||..|           |....||.:::...|....|.:||.:........||..
Zfish    19 SEMYYGSDSLPLGPRGYSPPEHHYQSYGVQCDSAPAVNPGRLGSPAGLLPPANPPKAYAEINSSE 83

  Fly   193 RSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNS 257
            ....:..:.|||:.:||||||||||||.||||.:|.:.|||:|||.:|..|||:|||||||||||
Zfish    84 PEFQELKSVYRRTLSHAKPPYSYISLICMAIQQSPAKRLTLNEIYDWIRQLFPYYRQNQQRWQNS 148

  Fly   258 IRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPS 322
            ||||||||||||::||:||.|||||:|.||||||||||||||:|||||||.:|            
Zfish   149 IRHSLSFNDCFVRVPRSPDSPGKGSYWALHPDSGNMFENGCYMRRQKRFKCQK------------ 201

  Fly   323 HSSLEATSPGKKDHEDSHHMHHHHHSRLDHHQHHKE-AGGASIAGVNVLSAAHSKDAEALAMLHA 386
                 :||.||....:...:.......:......|. ...|:......:|.|::|.|   :..|.
Zfish   202 -----STSTGKNSEGEDVKVEKKKKKEIKSVSSCKSPTSDATKQSSTTVSYANTKPA---SPSHL 258

  Fly   387 NAELCLSQQPQHV--PTHHHHQHHQLQQEELSAMMANRCHPSLITDYHSSMH-PLKQEPSGYTPS 448
            |        |.|.  ||         |..|:|..:     |||...:.:||. .|..|||    |
Zfish   259 N--------PSHTLFPT---------QPPEISTHL-----PSLSVPFPASMETSLHCEPS----S 297

  Fly   449 SH-PFSINRLL---------------PTESKADIKMY--DMSQYAGYNALS-PLTNS 486
            .| |.|:.||:               .:.|.|:...|  |...|.|::..| ||.:|
Zfish   298 QHQPISVPRLVDFQYCETPVSYPLYCQSNSHANFPSYTTDSVYYPGFSMCSTPLLSS 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 20/80 (25%)
FH 210..298 CDD:214627 69/87 (79%)
foxaNP_571357.2 FH 101..189 CDD:214627 69/87 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595992
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1181467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.