DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxd2

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_571346.2 Gene:foxd2 / 30525 ZFINID:ZDB-GENE-980605-6 Length:369 Species:Danio rerio


Alignment Length:354 Identity:115/354 - (32%)
Similarity:156/354 - (44%) Gaps:88/354 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 GAMPPGSREMETGS-------PNSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRML 231
            ||:.||...::..:       .:..|....|||    ......|||||||:||||||..:|.:.|
Zfish    56 GAISPGQSSLDCPADRVGQRDDSRTGALTGDKP----GKNALVKPPYSYIALITMAILQSPKKRL 116

  Fly   232 TLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFEN 296
            |||||.:||.:.||:||:....|||||||:||.|||||||||.|..||||::|||.|:|.:||:|
Zfish   117 TLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDN 181

  Fly   297 GCYLRRQKRFK-DEKKEAIRQLHKSPSHSSLEATS--PG------------KKDHEDSHHMHHHH 346
            |.:|||:|||| .:..|.:|           ||..  ||            :..:..:||.:|.|
Zfish   182 GSFLRRRKRFKRHQTNEILR-----------EAGGFLPGFGYGPYGYNYGLQLQNFHAHHPYHPH 235

  Fly   347 H--SRLDHHQHHKEAGGASIAGVNVLSAAHSKDAEALAMLHANAELCLSQQPQHVPTHHHHQHHQ 409
            |  |.......|......|    ::.|..||..:      ....||.....||..||        
Zfish   236 HPGSAFPFQNTHCALPTPS----SIFSTPHSLPS------FLGTELRKPFYPQLSPT-------- 282

  Fly   410 LQQEELSAMMANRCHPSLITDYHSSMHPLKQEPSGYTPSSHPFSINRLLPTESKADIKMYDMSQY 474
                          .|.|.        |||.:.:|  ||...|||:.::...| :....|.....
Zfish   283 --------------LPGLA--------PLKTDTNG--PSRPSFSIDNIIGAAS-SPASPYTTQPA 322

  Fly   475 AGYNALSPLT------NSHAALGQDSYYQ 497
            .....|:.||      .:|.::.|::..|
Zfish   323 GQAQILAMLTPTLASATNHLSITQETMLQ 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 8/41 (20%)
FH 210..298 CDD:214627 57/87 (66%)
foxd2NP_571346.2 Forkhead 95..181 CDD:278670 56/85 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.