DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxd5

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_571345.1 Gene:foxd5 / 30524 ZFINID:ZDB-GENE-980605-4 Length:321 Species:Danio rerio


Alignment Length:133 Identity:68/133 - (51%)
Similarity:89/133 - (66%) Gaps:2/133 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 EMETGSPNSLGRSRVD--KPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLF 244
            |::.....|.|.|..|  ..|...:..:..|||||||:||||||..:|.:.||||.|..||.:.|
Zfish    43 EVDHSGSESSGESESDFASSTVAPKQSSSVKPPYSYIALITMAILQSPMKKLTLSGICDFISNKF 107

  Fly   245 PFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDE 309
            |:|::....|||||||:||.||||:||||.|..||||::|:|.|.|.:||:||.:|||:||||..
Zfish   108 PYYKEKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWSLDPASEDMFDNGSFLRRRKRFKRN 172

  Fly   310 KKE 312
            :.|
Zfish   173 QPE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 6/28 (21%)
FH 210..298 CDD:214627 53/87 (61%)
foxd5NP_571345.1 Forkhead 73..159 CDD:278670 52/85 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.