DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxg1a

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_571142.1 Gene:foxg1a / 30274 ZFINID:ZDB-GENE-990415-267 Length:420 Species:Danio rerio


Alignment Length:409 Identity:111/409 - (27%)
Similarity:156/409 - (38%) Gaps:109/409 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 RRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDC 267
            :::..:.|||:||.:||.|||:.:|.:.|||:.||:|||..||:||:|:|.|||||||:||.|.|
Zfish   106 KKNGKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKC 170

  Fly   268 FVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPG 332
            |||:||..|.||||::|.|.|.|.::|..|...:.::|                     ..||..
Zfish   171 FVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRR---------------------STTSRA 214

  Fly   333 KKDHEDSHHMHHHHHSRLDHHQHHKEAGGASIAGVNVLSAAHSKDAEALAMLHANAELCLSQQPQ 397
            |                    ...|.....:..|:..:..|.|        |:......||    
Zfish   215 K--------------------LAFKRGARLTSTGLTFMDRAGS--------LYWPMSPFLS---- 247

  Fly   398 HVPTHHHHQHHQLQQEELSAMMANRCHPSLITDYHSSMHPLKQEPSGYT---PSSHPFSINRLLP 459
                    .||......||...|:..:||....| |:|  |.|...|..   |:|:..|::||: 
Zfish   248 --------LHHPRASSALSYNGASSAYPSHPMSY-STM--LTQNSLGNNHSFPASNGLSVDRLV- 300

  Fly   460 TESKADIKMYDMSQYAGYNALSPLTNSHAALGQDSYYQSLGYHAP-AGTTSLXHHQYPLAXGRAE 523
                              |...|....|......:.....|...| :||.||......|..|:..
Zfish   301 ------------------NGEIPYATHHLTAAALAASVPCGLSVPCSGTYSLNPCSVNLLAGQTS 347

  Fly   524 QMLRSQQQQHLQQQHQQHQQQQQQHQLHQQQQQMQQSAQQLTSASNTPATSAKASGKAGSASASG 588
            ...          .|..|.....|.......:....|:.|  :||:.|..|.:.|   .|:.:||
Zfish   348 YFF----------PHVPHPSMTSQSSTSMSSRAASSSSPQ--TASSLPCDSLRPS---LSSFSSG 397

  Fly   589 SGSG-------SGSGSGSN 600
            ..||       ...||.||
Zfish   398 LSSGLSDYFTHQNQGSTSN 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 0/5 (0%)
FH 210..298 CDD:214627 51/87 (59%)
foxg1aNP_571142.1 FH 113..201 CDD:214627 51/87 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.