DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and Foxd3

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:XP_008762182.2 Gene:Foxd3 / 29203 RGDID:621715 Length:469 Species:Rattus norvegicus


Alignment Length:493 Identity:141/493 - (28%)
Similarity:184/493 - (37%) Gaps:161/493 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 PSSMSYASMGSPLGNMGGCMAMSAASMSAAGLSGTYGAMPPGSREMETG--SPNSLGRSRVDKPT 200
            |.:::..|..:..||..|.   ..|.....|.....|...||:....||  :||....|.|    
  Rat    73 PQALALPSEATGPGNDTGA---PEADGCKGGEDAVTGGGGPGAGGGATGGLTPNKPKNSLV---- 130

  Fly   201 TYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFN 265
                     |||||||:||||||..:|.:.||||.|.:||.:.||:||:....|||||||:||.|
  Rat   131 ---------KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLN 186

  Fly   266 DCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQ-----LHKSPSHSS 325
            ||||||||.|..||||::|||.|.|.:||:||.:|||:||||..::|.:|:     :....::|.
  Rat   187 DCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKRFKRHQQEHLREQTALMMQSFGAYSL 251

  Fly   326 LEATSPGKKDHEDSHHMHHHHHSRLDHHQHHKEAGGASIAGVNVLSAAHSKDAEALAMLHANAEL 390
            ..|.|.|........|                   .|:.||      |:|..|.|.|...|.|  
  Rat   252 AAAASAGPYGRPYGLH-------------------PAAAAG------AYSHPAAAAAAAAAAA-- 289

  Fly   391 CLSQQPQHVPTHHHHQHHQLQQEELSAMMANRCHPSLITDYHSSMHPLKQEPSGYTPSSHPFSIN 455
              .|.|..:|.                 :|....|::         ||.  |||        .:.
  Rat   290 --LQYPYALPP-----------------VAPVLPPAV---------PLL--PSG--------ELG 316

  Fly   456 RLLPTESKADIKMYDMSQYAGYNALSPLTNSHAALGQDSYYQSLGYHAPAGTTSLXHHQYPLAXG 520
            |          |........|.:....|....||..      :.|....||||||.         
  Rat   317 R----------KAAAFGSQLGPSLQLQLNTLGAAAA------AAGTAGAAGTTSLI--------- 356

  Fly   521 RAEQMLRSQQQQHLQQQHQQHQQQQQQHQLHQQQQQMQQSAQQLTSASNT----PATSAKASGKA 581
                                               :.:.||:...|..|.    ||....::|..
  Rat   357 -----------------------------------KSEPSARPSFSIENIIGAGPAAPGSSAGGG 386

  Fly   582 GSASASGSGSGSGSGS---------GSNYSQKLQQQHQ 610
            |||..:|.|.|||.|.         |:..|..|...||
  Rat   387 GSAGGAGGGGGSGGGGSAQSFLRPPGTVQSAALMATHQ 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 16/72 (22%)
FH 210..298 CDD:214627 56/87 (64%)
Foxd3XP_008762182.2 FH_FOXD3 130..226 CDD:410821 61/108 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.