DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and Foxi1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_001099246.1 Gene:Foxi1 / 287185 RGDID:1307421 Length:372 Species:Rattus norvegicus


Alignment Length:476 Identity:123/476 - (25%)
Similarity:177/476 - (37%) Gaps:150/476 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PPPSNNNPNPTSNGGSMSPLARSAYTMN---SMGLPVGGMSSVSPQAAATFSSSVLDSAAAVASM 103
            |.||....:|........|...:.|..|   ..|:|       |||...:|..            
  Rat     7 PAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGMP-------SPQRPTSFEG------------ 52

  Fly   104 SASMSASMSASMNASMNGSMGAAAMNS---MGGNCMTPSSMSYASMGSPLGNMGGCMAMSAASMS 165
                            .|..||.. |.   :.|..|||......:..||       ....|..|.
  Rat    53 ----------------GGEYGATP-NPYLWLNGTAMTPPPYLPGTNASP-------FLPQAYGMQ 93

  Fly   166 AAGLSGTYGAMP-PGSREMETGSPNSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTR 229
            ...|....|.:| |...|:                      ....:|||||.:||.|||...|.:
  Rat    94 RQLLPSELGWLPIPSQEEL----------------------MKLVRPPYSYSALIAMAIHGAPDQ 136

  Fly   230 MLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMF 294
            .||||:|||::.|.||||.:::..|||||||:||.||||.|:||..|.||||::|||.|:...||
  Rat   137 RLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMF 201

  Fly   295 ENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKDHEDSHHMHHHHHSRLDHHQHHKEA 359
            :||.:.|::|| |.:...:...|....:.:.|.::||...:.::                     
  Rat   202 DNGNFRRKRKR-KSDASSSTGSLASEKTENRLLSSSPKPTEPQE--------------------- 244

  Fly   360 GGASIAGVNVLSAAHSKDAEALAMLHANAELCLSQQPQHVPTHHHHQHHQLQQEELSAMMANRCH 424
                     ||..| |.|..:     ::.|...|..|...|..::.         ||.|      
  Rat   245 ---------VLDTA-SPDTTS-----SSPEKRSSPAPSGTPCLNNF---------LSTM------ 279

  Fly   425 PSLITDYHSSMHPLKQEPSGYTPSSHPFSINRLLPTESKADIKMYDMSQYA-GYNALSPLTN--S 486
                |.|.:..:|:.:  |..||...|..:::              |.|.: .:|:.:||||  |
  Rat   280 ----TAYVNGTNPISR--SAATPGLSPEPVDK--------------MGQNSLNFNSYTPLTNLSS 324

  Fly   487 HAALGQDSY---YQSLGYHAP 504
            |...|:.:.   ..:|||..|
  Rat   325 HGNGGEWANPVPTNALGYGGP 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 17/92 (18%)
FH 210..298 CDD:214627 51/87 (59%)
Foxi1NP_001099246.1 FH 117..205 CDD:214627 51/87 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.