DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and Foxi2

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_899016.2 Gene:Foxi2 / 270004 MGIID:3028075 Length:311 Species:Mus musculus


Alignment Length:225 Identity:83/225 - (36%)
Similarity:124/225 - (55%) Gaps:24/225 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 GNCMTPSSMSYA-----SMGSPLGNMGGCMAMSAASMSAA------GLSGTYGAMP---PGSREM 183
            |:|..|..::.|     |.|....:.|..:.:::|::|.|      |.:.:|.|..   |||...
Mouse     9 GSCSVPHGLTRAIAHPPSYGRTDLSSGRRLWVNSAALSPAPYATGPGPAPSYAAATLAVPGSLLG 73

  Fly   184 ETGSPNSLGRSRVD----KPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLF 244
            .:|     |.:..|    ..:..:......:|||||.:||.||||:.|.|.||||:|||::...|
Mouse    74 ASG-----GLAGADLAWLSLSGQQELLRLVRPPYSYSALIAMAIQSAPLRRLTLSQIYQYVAGNF 133

  Fly   245 PFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDE 309
            |||::::..|||||||:||.||||.|:||..:.||||::|||.|:...||:||.: ||::|.:.|
Mouse   134 PFYKRSKAGWQNSIRHNLSLNDCFKKVPRDENDPGKGNYWTLDPNCEKMFDNGNF-RRKRRRRGE 197

  Fly   310 KKEAIRQLHKSPSHSSLEATSPGKKDHEDS 339
            ..||......||..::||......:|.:.|
Mouse   198 TSEAAVPGASSPEGTALEPRGSTPQDPQTS 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 19/93 (20%)
FH 210..298 CDD:214627 51/87 (59%)
Foxi2NP_899016.2 Forkhead 99..184 CDD:333958 49/84 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..237 12/41 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..294
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.