DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and sep1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_596301.1 Gene:sep1 / 2540866 PomBaseID:SPBC4C3.12 Length:663 Species:Schizosaccharomyces pombe


Alignment Length:320 Identity:85/320 - (26%)
Similarity:128/320 - (40%) Gaps:88/320 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 PPGSREMET---GSPNSLGRSRVDKPTTYRRSYTHA-KPPYSYISLITMAIQNNPTRMLTLSEIY 237
            ||..:.::|   .:| |:..|:..:|..:....... ||||||..||.|:|..:|.|.||||.||
pombe    92 PPSEQSLDTIIYRNP-SVSSSQSQEPEEFFLPLDDGKKPPYSYAMLIGMSIIRSPDRRLTLSAIY 155

  Fly   238 QFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRR 302
            .:|.:.|.||.::...|||||||:||.|..|:||.|..:.||||.||::.|.....|        
pombe   156 DWISNTFSFYNKSNNGWQNSIRHNLSLNKAFMKIERPRNLPGKGHFWSIRPGHEEQF-------- 212

  Fly   303 QKRFKDEKKEAIRQ--LHKSPSHSSLEATSPGKKDHEDSHHMHHHHHSRLDHHQHHKEAGGASIA 365
                   .|..:|:  ::..|:....:.||..|                      :..:.|:|  
pombe   213 -------LKLKLRKPGVNSRPAPPVQDVTSSTK----------------------YGSSTGSS-- 246

  Fly   366 GVNVLSAAHSKDAEALAMLHANAELCLSQQPQHVPTHHHHQHHQLQQEELSAMMANRCHPSLITD 430
            |.|..:.:                           .|..:|.||..|...:|.:.|  .|::...
pombe   247 GFNTFNTS---------------------------PHIFNQRHQYLQNYYTASLTN--IPTISNV 282

  Fly   431 YHSSMHPL-KQEPSGYTPSSHPFSINRLLPTESKADIKMYDMSQYAGYNALSPL---TNS 486
            ..::.||| .|:|...||.         :...|..:.|..|:...:..:..|||   |||
pombe   283 NATNFHPLHSQQPYVDTPG---------IDAPSDLEAKFSDLGVSSVVSVTSPLQSCTNS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 7/34 (21%)
FH 210..298 CDD:214627 44/87 (51%)
sep1NP_596301.1 COG5025 20..663 CDD:227358 85/320 (27%)
Forkhead 128..214 CDD:278670 44/100 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.