DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and mei4

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_595617.1 Gene:mei4 / 2540241 PomBaseID:SPBC32H8.11 Length:517 Species:Schizosaccharomyces pombe


Alignment Length:485 Identity:108/485 - (22%)
Similarity:168/485 - (34%) Gaps:116/485 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 THAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKI 271
            |..|||.||.:||.:||..:..:.||||.||.:|.:.|.:|..:...|||||||:||.|..|:|:
pombe    78 TGEKPPCSYATLIGLAILQSHNKQLTLSGIYTWIRNTFRYYLNHDGGWQNSIRHNLSLNKAFIKV 142

  Fly   272 PRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKDH 336
            .:...|..||.:||:.||....|                 .::| ||:|.|..|.....|..|.|
pombe   143 EKPKGKTLKGHYWTIDPDHMQNF-----------------VSVR-LHRSHSTDSNSKKRPSSKCH 189

  Fly   337 EDSHHMHH-----HHHSRLDHHQHHKEAGGASIAGVNVLSAAHSKDAEALAMLHANAELCLSQQP 396
            |.......     ...|||:.........|:|    :.::|..|.||               .||
pombe   190 EIKPLTTREIPLARKRSRLNSFNSSTSTSGSS----SNVAAEVSNDA---------------SQP 235

  Fly   397 QHVPTHHHHQHHQLQQEELSAMMANRCHPSLITDYHSSMHPLKQEPSGYTPSSHPFSINRLLPT- 460
            .:            |...|::.:.....|......:||......:|:..|...        ||| 
pombe   236 SN------------QDSSLNSNIVKPPLPPSNVQSNSSSSENVPKPNAETQED--------LPTI 280

  Fly   461 --------ESKADIKMYD------MSQYAGYNALSPLTNSHAALGQDSYYQSLGYHAPAGTTSLX 511
                    |:..|.::|:      |:...||:...|                 || ......|..
pombe   281 DAHESSLYENVNDSRLYEVPACRNMALNTGYSDADP-----------------GY-LRTSFRSNS 327

  Fly   512 HHQYPLAXGRAEQMLRS----QQQQHLQQQHQQHQQQQQQHQLHQQQQQMQQSAQQLTSASNTPA 572
            |:..|.:....|.:|::    .||..:...:...:.........::...::.|::   ....|..
pombe   328 HNSLPYSANEEEDVLQADFLVSQQSSMVSSYVSSRDPHSMPYYRREPIPLRPSSR---FYEYTRP 389

  Fly   573 TSAKASGKAGSASASGSGSGSGSGSGSNYSQKLQQQHQQQQQQQAAAQQQHHQQQQQLL--QELQ 635
            |..:......:..|..|...:...|..|||       :........:.|:|.:..:.||  .:|.
pombe   390 TYGRTDTSCSAPGAFCSTQINSPSSYINYS-------KCAPSSPTLSLQKHREHVKSLLYVPDLT 447

  Fly   636 -----EDSSNITSDLSEEQLQQHQAAQQQL 660
                 .|..|.:|.|..|.|....:.|..|
pombe   448 PSFDGSDPWNPSSQLLSEPLFDQHSFQSSL 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 1/1 (100%)
FH 210..298 CDD:214627 38/87 (44%)
mei4NP_595617.1 COG5025 1..517 CDD:227358 108/485 (22%)
Forkhead 81..167 CDD:278670 38/102 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.