DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and Foxd4

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:XP_001055972.2 Gene:Foxd4 / 252886 RGDID:621716 Length:432 Species:Rattus norvegicus


Alignment Length:143 Identity:74/143 - (51%)
Similarity:89/143 - (62%) Gaps:13/143 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 PGSREMETGS-------PNSLG------RSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTR 229
            ||:|.:...|       .||.|      ..|....||.......||||||||:||||||..:|.:
  Rat    58 PGARTLARRSAWDCGDLSNSSGFLRKFRAPRTRATTTTADGPQPAKPPYSYIALITMAILQSPHK 122

  Fly   230 MLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMF 294
            .||||.|..||...||:||:....|||||||:||.|||||||||.|..||||::|:|.|.|.:||
  Rat   123 RLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMF 187

  Fly   295 ENGCYLRRQKRFK 307
            :||.:|||:||||
  Rat   188 DNGSFLRRRKRFK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 10/43 (23%)
FH 210..298 CDD:214627 55/87 (63%)
Foxd4XP_001055972.2 Forkhead 103..189 CDD:278670 54/85 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.