DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and Foxa3

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:XP_038957314.1 Gene:Foxa3 / 25100 RGDID:2809 Length:361 Species:Rattus norvegicus


Alignment Length:417 Identity:156/417 - (37%)
Similarity:192/417 - (46%) Gaps:102/417 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 AAVASMSASMSASMSASMNASMNGSMGAAAMNS---MGGNCMTPSSMSYASMGSPLGNMGGCMAM 159
            |.|.:.||..|........|.:|..|....::|   .||...:|......:..:|...:|.....
  Rat    23 ADVRAESAVYSPVNPVPTMAPLNSYMSLNPLSSPYPPGGLQASPLPTGPLAPPAPTAPLGPTFPG 87

  Fly   160 SAASMSAAGLSGTYGAMPPG---SREMETGSPNSLGRSRVDKPTTYRRSYTHAKPPYSYISLITM 221
            ..|.....|.:..|||..||   .:||..|               |||...||||||||||||||
  Rat    88 LGAGSGTGGSASGYGAPGPGLVHGKEMAKG---------------YRRPLAHAKPPYSYISLITM 137

  Fly   222 AIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTL 286
            |||..|.:|||||||||:||||||:||:|||||||||||||||||||||:.|:||||||||:|.|
  Rat   138 AIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWAL 202

  Fly   287 HPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKDHEDSHHMHHHHHSRLD 351
            ||.||||||||||||||||||.|:|       ....:|:..||..|                   
  Rat   203 HPSSGNMFENGCYLRRQKRFKLEEK-------AKKGNSATSATRNG------------------- 241

  Fly   352 HHQHHKEAGGASIAGVNVLSAAHSKDAEALAMLHANAELCLSQQPQHVPTHHHHQHHQLQQEELS 416
                  ..|.|:.|.....:|..|                 ..|||..|.   .:......|::.
  Rat   242 ------TVGSATSATTTAATAVTS-----------------PAQPQPTPP---SEPEAQSGEDVG 280

  Fly   417 AMMANRCHPSLITDYHSSMH---PLKQE-PSGYTPSSHPFSINRLL----PTESKADIKMYDMSQ 473
            .:  :...|.....|.:.:.   .||.: |..:   :||||||.|:    .|.||.|:      .
  Rat   281 GL--DCASPPSSAPYFTGLELPGELKLDAPYNF---NHPFSINNLMSEQTSTPSKLDV------G 334

  Fly   474 YAGYNALSPLTNSHAALGQDS-YYQSL 499
            :.||.|.|         |:.. |||||
  Rat   335 FGGYGAES---------GEPGVYYQSL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 21/94 (22%)
FH 210..298 CDD:214627 74/87 (85%)
Foxa3XP_038957314.1 FH_FOXA3 124..225 CDD:410814 87/100 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 166 1.000 Domainoid score I3778
eggNOG 1 0.900 - - E2759_KOG3563
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1181467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11829
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.