DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and FOXD2

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_004465.3 Gene:FOXD2 / 2306 HGNCID:3803 Length:495 Species:Homo sapiens


Alignment Length:356 Identity:115/356 - (32%)
Similarity:144/356 - (40%) Gaps:120/356 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SAPVSMASSGGGGPPSGGGGGGGG-GGGGGPPPPSNNNPNPTSNGGSMSPLARSAYTMNSMGLPV 75
            |:|.:::.:.......|||.|||. ....||..|.:..|:     |...|...:...:.......
Human    15 SSPAALSEADADIDVVGGGSGGGELPARSGPRAPRDVLPH-----GHEPPAEEAEADLAEDEEES 74

  Fly    76 GGMSSVSPQAAATFSSSVLDSAAAVASMSASMSASMSASMNASMNGSMGAAAMNSMGGNCMTPSS 140
            ||.|...|:|.|                                  |.|||              
Human    75 GGCSDGEPRALA----------------------------------SRGAA-------------- 91

  Fly   141 MSYASMGSPLGNMGGCMAMSAASMSAAGLSGTYGAMPPGSREMETGSPNSLGRSRVDKPTTYRRS 205
               |:.|||                ..|.:...||..||     .|.|:  |.:....|.     
Human    92 ---AAAGSP----------------GPGAAAARGAAGPG-----PGPPS--GGAATRSPL----- 125

  Fly   206 YTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVK 270
               .|||||||:||||||..:|.:.||||||.:||...||:||:....|||||||:||.||||||
Human   126 ---VKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVK 187

  Fly   271 IPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKD 335
            |||.|..||||::|||.|:|.:||:||.:|||:||||       ||....|              
Human   188 IPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFK-------RQPLPPP-------------- 231

  Fly   336 HEDSHHMHHHHHSRLDHHQHHKEAGGASIAG 366
                 |.|.|.|..|      ...|||:.||
Human   232 -----HPHPHPHPEL------LLRGGAAAAG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 17/88 (19%)
FH 210..298 CDD:214627 57/87 (66%)
FOXD2NP_004465.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 14..122 36/185 (19%)
Forkhead 127..213 CDD:278670 56/85 (66%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..347
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..444
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.