DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and FOXL1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_005241.1 Gene:FOXL1 / 2300 HGNCID:3817 Length:345 Species:Homo sapiens


Alignment Length:191 Identity:84/191 - (43%)
Similarity:107/191 - (56%) Gaps:35/191 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 RSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCF 268
            |:.|..|||||||:||.||||:.|.:.:||:.|||||||.||||..|:|.|||||||:||.||||
Human    43 RAETPQKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNDCF 107

  Fly   269 VKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGK 333
            ||:||...:|||||:|||.|...:|||||.|.||:::.|             |...:.||..|..
Human   108 VKVPREKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPK-------------PGPGAPEAKRPRA 159

  Fly   334 KDHEDSHHMHHHHHSRLDHHQHHKEAG---GASIAGVNVLSAAHSKDAEAL------AMLH 385
            :.|:.|             .:...|||   |.|...::.|.||.:..:..|      |.||
Human   160 ETHQRS-------------AEAQPEAGSGAGGSGPAISRLQAAPAGPSPLLDGPSPPAPLH 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 2/4 (50%)
FH 210..298 CDD:214627 59/87 (68%)
FOXL1NP_005241.1 FH 49..137 CDD:214627 59/87 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..289 23/98 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.