DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and FOXF1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_001442.2 Gene:FOXF1 / 2294 HGNCID:3809 Length:379 Species:Homo sapiens


Alignment Length:615 Identity:141/615 - (22%)
Similarity:205/615 - (33%) Gaps:261/615 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SSAPVSMASSGGGGPPSGGGGGGGGGGGGGPPPPSNNNPNPTSNGGSMSPLARSAYTMNSMGLPV 75
            ||||....      ||.|||||||||||....|                                
Human     2 SSAPEKQQ------PPHGGGGGGGGGGGAAMDP-------------------------------- 28

  Fly    76 GGMSSVSPQAAATFSSSVLDSAAAVASMSASMSASMSASMNASMNGSMGAAAMNSMGGNCMTPSS 140
                                         ||...|.:...||                       
Human    29 -----------------------------ASSGPSKAKKTNA----------------------- 41

  Fly   141 MSYASMGSPLGNMGGCMAMSAASMSAAGLSGTYGAMPPGSREMETGSPNSLGRSRVDKPTTYRRS 205
                                                  |.|..|                     
Human    42 --------------------------------------GIRRPE--------------------- 47

  Fly   206 YTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVK 270
                |||||||:||.||||::||:.|||||||||:...|||:|.:.|.|:||:||:||.|:||:|
Human    48 ----KPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIK 108

  Fly   271 IPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKD 335
            :|:...:||||.:||:.|.|..|||.|.:.||.:.|: .|.:|::     |.:|.:....     
Human   109 LPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFR-RKCQALK-----PMYSMMNGLG----- 162

  Fly   336 HEDSHHMHHHHHSRLDHHQHHKEAGGASI--------AGVNVLSAAHSKDAEALAMLHANAELCL 392
               .:|:.       |.:.....|||.|.        .|:.:::.....:.:.:|:        .
Human   163 ---FNHLP-------DTYGFQGSAGGLSCPPNSLALEGGLGMMNGHLPGNVDGMAL--------P 209

  Fly   393 SQQPQHVPTHHHHQHHQLQQEELSAMMANRCHPSLITDY--HSSMHPLKQEPSGYTPSSHPFSIN 455
            |....|:|::..|.:            ...|..:...:|  |.|..|                .:
Human   210 SHSVPHLPSNGGHSY------------MGGCGGAAAGEYPHHDSSVP----------------AS 246

  Fly   456 RLLPTESKADIKMYDMSQYAGYNALSPLTNSHAALGQDSYY---QSLGYHAPAG---TTSLXHHQ 514
            .||||.:...::.:  :.|:|..|..| .::.|||...:.|   |.|....||.   :.||..| 
Human   247 PLLPTGAGGVMEPH--AVYSGSAAAWP-PSASAALNSGASYIKQQPLSPCNPAANPLSGSLSTH- 307

  Fly   515 YPLAXGRAEQMLRSQQQQHL-QQQHQQHQQQQQQHQLHQQQQQMQQSAQQLTSASNTPATSAKAS 578
                         |.:|.:| |..|....:.|...:.|.|...|....:.:.             
Human   308 -------------SLEQPYLHQNSHNAPAELQGIPRYHSQSPSMCDRKEFVF------------- 346

  Fly   579 GKAGSASASGSGSGSGSGSGSNYSQKLQQQ 608
                |.:|..|.|...:|.||.|.|::..|
Human   347 ----SFNAMASSSMHSAGGGSYYHQQVTYQ 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 3/88 (3%)
FH 210..298 CDD:214627 52/87 (60%)
FOXF1NP_001442.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 24/170 (14%)
FH 48..136 CDD:214627 52/87 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.