DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and pes-1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_001023406.1 Gene:pes-1 / 177267 WormBaseID:WBGene00003976 Length:264 Species:Caenorhabditis elegans


Alignment Length:185 Identity:64/185 - (34%)
Similarity:97/185 - (52%) Gaps:28/185 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 NC--MTPSSMSYASMGSPLGNMGG------CMAMSAASMSAAGLS--GTYGAMPPGSREMETGSP 188
            ||  :.|:....||.|:  ..|.|      |:.:.:::.|:..:|  .::........:.::|. 
 Worm    18 NCSSLPPTPPKTASPGN--SKMKGFNISDLCLDLDSSTSSSCSVSPASSFHTRSESVGQQQSGR- 79

  Fly   189 NSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYR-QNQQ 252
            ||...|..:.||        .:|.|||.:||.||||::|.:.|.:||||::|...|.:|: |...
 Worm    80 NSPVSSSTESPT--------KRPKYSYNALIAMAIQSSPFKSLRVSEIYKYISSNFSYYKNQKPL 136

  Fly   253 RWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGN--MFENGC-YLRRQK 304
            :||||:||:||.:..|.|: ||.|  ||||:|.:..|.|.  ...|.| .|||||
 Worm   137 QWQNSVRHNLSLHKEFRKV-RTLD--GKGSYWAMTADLGTDVYISNNCGKLRRQK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 17/84 (20%)
FH 210..298 CDD:214627 41/90 (46%)
pes-1NP_001023406.1 FH 93..168 CDD:238016 38/77 (49%)
rad23 <203..>240 CDD:273167
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.