DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and unc-130

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_496411.1 Gene:unc-130 / 174721 WormBaseID:WBGene00006853 Length:333 Species:Caenorhabditis elegans


Alignment Length:249 Identity:81/249 - (32%)
Similarity:117/249 - (46%) Gaps:75/249 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 DKPTTYRRSY------THAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQ 255
            |..:|.|:|.      :|||||||||:||.|:|.|:|.:.||||||.:||::.|.:|::....||
 Worm   108 DDDSTSRKSMSGHRKSSHAKPPYSYIALIAMSILNSPEKKLTLSEICEFIINKFEYYKEKFPAWQ 172

  Fly   256 NSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKS 320
            |||||:||.||||||:.|.|..||||::|.|.|:..:||:||.:|||:||:              
 Worm   173 NSIRHNLSLNDCFVKVARGPGNPGKGNYWALDPNCEDMFDNGSFLRRRKRY-------------- 223

  Fly   321 PSHSSLEATSPGKKDHEDSHHMHHHH--------------HSRLDHHQHHKEAGGASIAGVNVLS 371
                        ||:.:..|.|..||              ..|:.|..            .|:..
 Worm   224 ------------KKNSDTYHEMMSHHPMPFPPFLPQGMPFPPRMMHPM------------ANIPM 264

  Fly   372 AAHSKDAEALAMLHANAELCLSQQPQHVPTHHHHQHHQLQQEELSAMMANRCHP 425
            ..|..:..|:..:.|          ..:|       ..:..::|.:|||:|..|
 Worm   265 LGHPMNPRAVPNMPA----------FFIP-------QNIDSQKLLSMMASRIMP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 4/17 (24%)
FH 210..298 CDD:214627 50/87 (57%)
unc-130NP_496411.1 COG5025 <126..330 CDD:227358 76/231 (33%)
Forkhead 127..212 CDD:365978 48/84 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.