DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and fkh-8

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_001254107.1 Gene:fkh-8 / 174026 WormBaseID:WBGene00001440 Length:328 Species:Caenorhabditis elegans


Alignment Length:147 Identity:51/147 - (34%)
Similarity:70/147 - (47%) Gaps:37/147 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 SPNSLGRSRV-------------DKPTT------YRRSYTHA-KPPYSYISLITMAIQNNPTRML 231
            :||.:|...|             .||..      .||.:..| ||||||..||.:||::.|.:..
 Worm    31 NPNIVGSVNVSPLVLSPTVPAETSKPVAPAHEGKRRRIFDGADKPPYSYSQLIRLAIEDTPDKKC 95

  Fly   232 TLSEIYQFIMDLFPFYRQNQ-QRWQNSIRHSLSFNDCFVKIPRTP----------DKPG------ 279
            ||:|||.||...|.|||:|: ..|:|||||:||.|..|.:|.:|.          |.|.      
 Worm    96 TLAEIYSFIAHNFQFYRENRNSSWKNSIRHNLSLNKQFSRIEKTDGDRRGWWVCVDPPAKKPRIL 160

  Fly   280 KGSFWTLHPDSGNMFEN 296
            |||...::|...:::.|
 Worm   161 KGSPVRVNPIYEHLYHN 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 8/40 (20%)
FH 210..298 CDD:214627 42/104 (40%)
fkh-8NP_001254107.1 COG5025 30..>217 CDD:227358 51/147 (35%)
FH 74..156 CDD:214627 37/81 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.