DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and let-381

DIOPT Version :10

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_491826.1 Gene:let-381 / 172331 WormBaseID:WBGene00002601 Length:362 Species:Caenorhabditis elegans


Alignment Length:105 Identity:44/105 - (41%)
Similarity:63/105 - (60%) Gaps:3/105 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 KPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRT 274
            |||:|||:||.|||...|.:..||:|||.::.:.|.|:|.....|:|||||:||.|:||||:|:.
 Worm    72 KPPFSYIALIAMAISKRPDKKATLAEIYSYLQENFEFFRGEYAGWRNSIRHNLSLNECFVKLPKD 136

  Fly   275 PD---KPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKK 311
            ..   :..||..||:......|.|...:.||.:.:|..|:
 Worm   137 TGESYRGRKGHKWTISDSCEFMLEENGFRRRPRGYKARKR 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:369872
FH_dFKH 210..307 CDD:410815 42/99 (42%)
let-381NP_491826.1 FH_FOXF 73..153 CDD:410794 37/79 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.