DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and Foxd1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_032268.2 Gene:Foxd1 / 15229 MGIID:1347463 Length:456 Species:Mus musculus


Alignment Length:297 Identity:103/297 - (34%)
Similarity:127/297 - (42%) Gaps:94/297 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GGGGGGGGGPPPPSNNNPNPTSNGGSMSPLARSAYTMNSMGLPVGGMSSVSPQAAATFSSSVLDS 96
            ||||.||||...||:......|..|.                  ..:..:..:.         |.
Mouse    38 GGGGRGGGGSRLPSSAQRRRRSYAGE------------------DDLEDLEEED---------DD 75

  Fly    97 AAAVASMSASMSASMSASMNASMNGSMGAAAMNSMGGNCMTPSSMSYASMGSPLGNMGGCMAMSA 161
            ...:||..|:..|                           .|........||     |||....|
Mouse    76 DLLLASRPAASPA---------------------------PPGPAPAPGTGS-----GGCSGAGA 108

  Fly   162 ASMSAAGLSGTYGAMPPGSREMETGSPNSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNN 226
                ..|..|..||...|      |:.|.|                 .|||||||:||||||..:
Mouse   109 ----GGGAGGGTGAGTGG------GAKNPL-----------------VKPPYSYIALITMAILQS 146

  Fly   227 PTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSG 291
            |.:.||||||.:||...||:||:....|||||||:||.|||||||||.|..||||::|||.|:|.
Mouse   147 PKKRLTLSEICEFISSRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESA 211

  Fly   292 NMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEA 328
            :||:||.:|||:||||       ||...:| |::.||
Mouse   212 DMFDNGSFLRRRKRFK-------RQPLLAP-HAAAEA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 15/88 (17%)
FH 210..298 CDD:214627 57/87 (66%)
Foxd1NP_032268.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104 22/124 (18%)
Forkhead 130..216 CDD:278670 56/85 (66%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..322
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..401
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.