DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and Foxf1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_034556.2 Gene:Foxf1 / 15227 MGIID:1347470 Length:378 Species:Mus musculus


Alignment Length:453 Identity:124/453 - (27%)
Similarity:186/453 - (41%) Gaps:110/453 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 GTYGAMPPGSREMETGSPNSLGRSRVDKPTT-YRRSYTHAKPPYSYISLITMAIQNNPTRMLTLS 234
            ||.|....|.:.|:   |.:.|.::..|... .||.   .|||||||:||.||||::|::.||||
Mouse    14 GTGGGGGAGGQAMD---PAAAGPTKAKKTNAGVRR
P---EKPPYSYIALIVMAIQSSPSKRLTLS 72

  Fly   235 EIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCY 299
            |||||:...|||:|...|.|:||:||:||.|:||:|:|:...:||||.:||:.|.|..|||.|.:
Mouse    73 EIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSF 137

  Fly   300 LRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKDHEDSHHMHHHHHSRLDHHQHHKEAGGASI 364
            .||.:.|: .|.:|::     |.:|.:....                .:.|......:.:||.|.
Mouse   138 RRRPRGFR-RKCQALK-----PVYSMVNGLG----------------FNHLPDTYGFQGSGGLSC 180

  Fly   365 A--------GVNVLSAAHSKDAEALAMLHANAELCLSQQPQHVPTHHHHQHHQLQQEELSAMMAN 421
            |        |:.:::...:.:.:.:|:        .|....|:|::..|.:            ..
Mouse   181 APNSLALEGGLGMMNGHLAGNVDGMAL--------PSHSVPHLPSNGGHSY------------MG 225

  Fly   422 RCHPSLITDY--HSSMHPLKQ-EPSGYTPSSHPFSINRLLPTESKADIKMYDMSQYAGYNALSPL 483
            .|..|...:|  |.|..|... .|:|......|.::              |..|..|...|.|..
Mouse   226 GCGGSAAGEYPHHDSSVPASPLLPAGAGGVMEPHAV--------------YSSSAAAWPPAASAA 276

  Fly   484 TNSHAALGQDSY--YQSLGYHAPAGTTSLXHHQYPLAXGRAEQMLRSQQQQHL-QQQHQQHQQQQ 545
            .||.|     ||  .|.|....||..        ||:...:...|   :|.:| |..|....:.|
Mouse   277 LNSGA-----SYIKQQPLSPCNPAAN--------PLSGSISTHSL---EQPYLHQNSHNGPAELQ 325

  Fly   546 QQHQLHQQQQQMQQSAQQLTSASNTPATSAKASGKAGSASASGSGSGSGSGSGSNYSQKLQQQ 608
            ...:.|.|...|....:.:.                 |.:|..|.|...:|.||.|.|::..|
Mouse   326 GIPRYHSQSPSMCDRKEFVF-----------------SFNAMASSSMHTTGGGSYYHQQVTYQ 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 10/38 (26%)
FH 210..298 CDD:214627 51/87 (59%)
Foxf1NP_034556.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 8/33 (24%)
Forkhead 48..133 CDD:306709 49/84 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.