DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and Foxq1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_032265.3 Gene:Foxq1 / 15220 MGIID:1298228 Length:400 Species:Mus musculus


Alignment Length:262 Identity:88/262 - (33%)
Similarity:123/262 - (46%) Gaps:59/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 AAAMNSMG------GNCMTPSSMSYASMGSPLGNMGGCMAMSAASMSAAG-LSGTYGAMPPGSRE 182
            ||..:.||      |:...||.:|.|...| ||:.|.|.|.|.|:.|.|| |.|      .|...
Mouse    10 AAHGDKMGSDLEGAGSSDVPSPLSAAGDDS-LGSDGDCAANSPAAGSGAGDLEG------GGGER 67

  Fly   183 METGSPNSL-------------------------GRSRVDKPTTYRRSYTHAKPPYSYISLITMA 222
            ..:|.|::.                         |.....||.|.|     .|||||||:||.||
Mouse    68 NSSGGPSAQDGPEATDDSRTQASAAGPCAGGVGGGEGARSKPYTR
R-----PKPPYSYIALIAMA 127

  Fly   223 IQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKP-GKGSFWTL 286
            |:::....|||:||.:::|..|||:|.:...|:||:||:||.||||||:.|.|.:| ||.::|.|
Mouse   128 IRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWML 192

  Fly   287 HPDSGNMFENGCYLRRQKRFKDE---KKEAIRQLHKSP-----------SHSSLEATSPGKKDHE 337
            :|:|...|.:|.:.||:||....   ....:|.....|           :.||..|.||.:::..
Mouse   193 NPNSEYTFADGVFRRRRKRLSHRTTVSASGLRPEEAPPGPAGTPQPAPAARSSPIARSPARQEER 257

  Fly   338 DS 339
            .|
Mouse   258 SS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 30/115 (26%)
FH 210..298 CDD:214627 45/88 (51%)
Foxq1NP_032265.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..112 28/108 (26%)
FH 115..193 CDD:238016 41/77 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..264 8/47 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.