DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and Foxb2

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_032049.1 Gene:Foxb2 / 14240 MGIID:1347468 Length:428 Species:Mus musculus


Alignment Length:341 Identity:124/341 - (36%)
Similarity:168/341 - (49%) Gaps:44/341 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 PTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLS 263
            |...:.||:..|||||||||..||||::..:||.||:||:|||:.||:||::.||||||:||:||
Mouse     2 PRPGKSSYSDQKPPYSYISLTAMAIQHSAEKMLPLSDIYKFIMERFPYYREHTQRWQNSLRHNLS 66

  Fly   264 FNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLH---KSPSHSS 325
            |||||:||||.||:|||||||.||||.|:|||||.:|||:||||     .:|..|   .|.|...
Mouse    67 FNDCFIKIPRRPDQPGKGSFWALHPDCGDMFENGSFLRRRKRFK-----VLRADHAHLHSGSSKG 126

  Fly   326 LEATSPGKKDH----EDSHHMHHHHHSRLDHHQHHKEAGGASIAGVNVLSAAHSKDAEALAMLHA 386
            ...|.||...|    ..:||.|||||....||.||...........:::...|.:.|.|....|.
Mouse   127 APGTGPGGHLHPHHPHHAHHHHHHHHHAAHHHHHHHPPQPPPPPPPHMVPYFHQQPAPAPQPPHL 191

  Fly   387 NAELCLSQQPQHVPTHHHHQHHQLQQEELSAMMANRCHPSLITDYHSSMHPLKQEP--------- 442
            .::.....|||..|....|.....:...::|..|.....::     .|:..|.|.|         
Mouse   192 PSQPAQQPQPQSQPPQTSHPGKMQEAAAVAAAAAAAAAAAV-----GSVGRLSQFPPYGLGSAAA 251

  Fly   443 ------SGYTPSSHPFSINRLLPTESK-----ADIKMYDMSQYAGYNALSPLTN------SHAAL 490
                  :..|...|||:|..::..:.|     ..:.:..:..:.||.....|:|      .|..:
Mouse   252 AAAAAAASTTGFKHPFAIENIIGRDYKGVLQAGGLPLASVMHHLGYPVPGQLSNVVGSVWPHVGV 316

  Fly   491 GQDSYYQSLGYHAPAG 506
             .||...:....|.||
Mouse   317 -MDSVAAAAAAAAAAG 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 3/9 (33%)
FH 210..298 CDD:214627 63/87 (72%)
Foxb2NP_032049.1 FH 13..101 CDD:214627 63/87 (72%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..217 26/98 (27%)
E_Pc_C <342..>406 CDD:284226
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 408..428
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.