DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and Foxs1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_034356.1 Gene:Foxs1 / 14239 MGIID:95546 Length:329 Species:Mus musculus


Alignment Length:148 Identity:77/148 - (52%)
Similarity:95/148 - (64%) Gaps:17/148 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 SPNSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQ 251
            ||.||..|.  :||         |||||||:||.||||::|.:..|||.||::||..|.|||.|:
Mouse     6 SPESLAPSA--EPT---------KPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNR 59

  Fly   252 QRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQ 316
            ..|||||||:||.|:||||:||...||||||:|||.||..:||::|.:|||::||   .|....|
Mouse    60 PGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFQHGSFLRRRRRF---TKRTGAQ 121

  Fly   317 LHKSP---SHSSLEATSP 331
            ..|.|   .|....||||
Mouse   122 GTKGPVKIDHRPHRATSP 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 7/21 (33%)
FH 210..298 CDD:214627 55/87 (63%)
Foxs1NP_034356.1 Forkhead 18..103 CDD:278670 54/84 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..150 8/23 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.